KEGG   Sphingobium sp. SYK-6: SLG_28320Help
Entry
SLG_28320         CDS       T01622                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
Organism
ssy  Sphingobium sp. SYK-6
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Peptidase_M75
Motif
Other DBs
NCBI-ProteinID: BAK67507
NITE: SLG_28320
UniProt: G2IKV5
LinkDB All DBs
Position
complement(3064267..3065739)
Genome map
AA seq 490 aa AA seqDB search
MDQFNKTIKGIKDRGAAQLFIDGEWRASSGSNELTVVTPHNEETVLTYIEPTTADVDIAV
AAARKAFDQGPWPRMSPAERGTYLKKVSDLLMARMPELAEAWTGQVGAVIGFTSKASYQV
PGLFKFYGELNDSYPFIEERIGSMGGNKVRVVQEPVGVVAAVTPWNAPLVLLVYKVAAAL
AAGCTMVCKPSPETPIDAHILAECIKDAGIPAGVFNMLPAGREVGDHLIRHPGVDKISFT
GSTAAGKHIAGVASERLARVSLELGGKSAAMILEDADMDHVLKSLVPYSMPITGQVCFSL
TRVLVPKSRKAEIVDAYTSAVSKVKVGDPFQADVGMGPLTMQRQLERVQGYIEKGKAEGA
TLALGGGRPADLNRGFFVEPTVFTDVDPNMTIFKEEIFGPVVSFVDYDNEADMIAKANDT
IYGLHGAVYTQDAERGFAVAREYRAGSVTINGMMVDIHMPFGGFKQSGIGRDGGLEGLEN
YLETKAVYFA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggatcagttcaacaagacgatcaaaggcatcaaggatcggggcgcggcgcagctcttc
atcgatggtgaatggcgcgccagcagtggcagcaacgagctgaccgtcgtcacgccccat
aatgaggaaacggtcctcacctatatcgagccgacgacagcggatgtcgacattgccgtg
gccgccgcgcgcaaggcgttcgatcaggggccctggccgcgcatgtcgccggccgagcgt
ggcacctatctcaagaaagtgtccgaccttctgatggcgcggatgcccgagctcgccgaa
gcctggacgggtcaggtcggcgccgtgatcggcttcaccagcaaggccagctatcaggtg
ccgggcctgttcaaattctatggcgagctgaacgacagctatccgttcatcgaggagcgc
atcggctccatgggcggcaacaaggtgcgcgtggtgcaggagcccgtgggcgtcgtcgcg
gcggtcacgccgtggaatgcgccgctcgtgctgctcgtctacaaggtcgcggccgcgctg
gcggcgggctgcaccatggtgtgcaagccgagcccggaaacgccgatcgacgcgcacatc
ctcgccgagtgcatcaaggatgccggcatcccggccggcgtgttcaacatgctgccggcg
ggccgcgaagtgggcgatcatctgatccgccatcccggcgtggacaagatcagcttcacc
ggctccacggcggccggcaagcatatcgcgggcgttgcctccgagcgccttgcccgcgtc
tcgctggagctgggcggcaagtcggcggcgatgatcctcgaggatgcggacatggatcat
gtcctcaagagcctcgtgccttattccatgccgatcacgggccaggtctgcttctcgctg
acccgcgttctcgtgcccaagagccgcaaggccgagatcgtcgacgcctacaccagcgcc
gtttcgaaagtgaaggtgggcgatcccttccaggccgatgtcggcatgggtccgctcacc
atgcagcgccagctcgagcgcgtgcagggctatatcgagaagggcaaggccgagggcgcg
accctcgcgctgggcggcgggcgtcccgccgatctcaaccgcggcttcttcgtcgaaccg
accgtgttcaccgacgtcgatccgaacatgacgatcttcaaggaagagattttcggcccg
gtcgtctccttcgtcgattatgacaatgaggcggacatgatcgccaaggccaatgacacg
atctacggcctgcacggcgcggtctacacgcaggacgccgagcgcggcttcgcggtggcc
cgggagtatcgcgccggttcggtcaccatcaacggcatgatggtggatatccacatgccc
ttcggcggcttcaagcagtccggcatcggccgtgacggcggcctcgaggggctggagaat
tatctcgagaccaaggcggtctatttcgcctga

DBGET integrated database retrieval system