KEGG   Stanieria sp. NIES-3757: STA3757_22890Help
Entry
STA3757_22890     CDS       T05130                                 

Gene name
rbcS
Definition
(GenBank) Ribulose bisphosphate carboxylase, small subunit
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
stan  Stanieria sp. NIES-3757
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:stan00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    STA3757_22890 (rbcS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    STA3757_22890 (rbcS)
Enzymes [BR:stan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     STA3757_22890 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2495724..2496059
Genome map
AA seq 111 aa AA seqDB search
MKTLPKERRYETLSFLPPLTDQQIAKQIDYMLEQGFIPGVEFEKDPTPELHHWTLWKLPL
FDARNAQDVLNEVRECRSEYSDCYIRVVGFDNIKQCQTVSFIVYKPNSNRY
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattaccaaaagagcgtcgttacgaaaccctttcttttttacctcctttaacc
gatcagcaaatcgccaagcaaatcgattatatgctcgagcagggttttattcctggggtt
gagtttgaaaaagatcctactcctgaacttcaccactggactttgtggaagttaccttta
tttgatgccagaaacgctcaagatgtacttaatgaagttagagaatgtcgctctgaatac
tctgattgttacatccgtgtagttggttttgacaacattaagcaatgtcaaactgttagc
ttcattgtttacaaacccaattctaatcgctactaa

DBGET integrated database retrieval system