KEGG   Sphingomonas taxi: MC45_11665Help
Entry
MC45_11665        CDS       T03398                                 

Definition
(GenBank) kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
stax  Sphingomonas taxi
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stax00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    MC45_11665
Enzymes [BR:stax01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     MC45_11665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2570342..2571556
Genome map
AA seq 404 aa AA seqDB search
MTREDARALDRADPLAPFRDRFALPEGLIYLDGNSLGVLPRAVIPALADTVQRQWGERLI
RSWNEGWIDAPQRLGAKIAPLIGAAADEVIVGDTTSTHLFKALVAALRHDPARRTIVSEA
GNFPTDLHIAEGAVACVAGTALKVVDRADLAAALDDDTAVLLLTHVHYKTAERFDLADWT
ARAHAAGALILWDFSHSVGAVPIDVTAAGADMAVGCTYKYLNGGPGAPAFLYVARRLHDA
LANPVSGWMGHAEPFAFTDAYRPAAGMKRWLVGTPSILAMASLEAALDLWRDIDLTQIAA
KSAALFAILAEAGAAAGLPCVSPTDPARRGSHISFRHDHAYEVTQALIARGVIGDFRAPD
VLRLGLTPLYLSHEDVWRAGEHLRDVIATEAWRNAAYAERNAVT
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgaagacgcccgcgccctcgaccgcgccgacccgctcgcgccgttccgcgac
cgtttcgcgctgcccgagggcctcatctatctcgacggcaattcgctcggcgtgctgccg
cgcgccgtcatccccgcgcttgccgacaccgtccagcggcaatggggcgagcggctgatc
cgcagctggaacgaaggctggatcgacgccccccagcgcctcggcgcgaagatcgcgccg
ctgatcggcgccgccgcggacgaggtgatcgtcggcgacaccacctcgacgcatctgttc
aaggcgctggtcgccgcgctccgccacgatcccgcccgccgcacgatcgtcagcgaggcg
ggcaatttccccaccgacctccacatcgccgagggcgcggtcgcctgcgtggcgggcacg
gcgctgaaggtcgtcgatcgcgccgacctcgccgccgcgctcgacgacgataccgccgtg
ctgctgctcacccacgtccattacaagaccgccgaacgcttcgacctcgccgactggacc
gcccgcgcgcacgccgccggtgcgctgatcctctgggacttcagccacagcgtcggcgcg
gtgccgatcgacgtcaccgccgccggtgccgacatggcggtcggctgcacctacaaatat
ctcaacggcggtcccggcgcccccgccttcctctacgtcgcgcgccggctgcacgacgcg
ctcgccaatccggtcagcggctggatgggccatgccgagcccttcgccttcaccgatgcc
tatcgccccgccgcgggcatgaagcgctggctggtcggcaccccgtcgatcctcgcgatg
gcgagcctcgaggccgcgctcgacctctggcgcgacatcgacctgacgcagatcgccgcc
aagagcgccgcgctcttcgccatcctcgccgaggcgggcgccgccgccggcctcccctgc
gtcagcccgaccgacccggcgcggcgcggcagccacatcagcttccgccacgaccacgcc
tatgaggtgacgcaggccctgatcgcccgcggcgtcatcggcgacttccgcgcccccgat
gtgctgcgcctcggcctgaccccgctctacctcagccacgaggacgtgtggcgcgccggc
gaacacctccgcgacgtcatcgccaccgaggcatggcgcaacgccgcttatgccgaacgc
aacgccgtgacctga

DBGET integrated database retrieval system