KEGG   Streptococcus pseudopneumoniae: SPPN_10240Help
Entry
SPPN_10240        CDS       T01590                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
std  Streptococcus pseudopneumoniae
Pathway
std00220  Arginine biosynthesis
std00250  Alanine, aspartate and glutamate metabolism
std00290  Valine, leucine and isoleucine biosynthesis
std01100  Metabolic pathways
std01110  Biosynthesis of secondary metabolites
std01130  Biosynthesis of antibiotics
std01210  2-Oxocarboxylic acid metabolism
std01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:std00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SPPN_10240
   00290 Valine, leucine and isoleucine biosynthesis
    SPPN_10240
   00220 Arginine biosynthesis
    SPPN_10240
Enzymes [BR:std01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SPPN_10240
    2.6.1.66  valine---pyruvate transaminase
     SPPN_10240
Amino acid related enzymes [BR:std01007]
 Aminotransferase (transaminase)
  Class I
   SPPN_10240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 MHC_II_alpha Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AEL11454
UniProt: G0I7X9
LinkDB All DBs
Position
complement(1940396..1941610)
Genome map
AA seq 404 aa AA seqDB search
MKEYNKSSKLEHVAYDIRGPVLEEAMRMRANGEKILRLNTGNPAEFGFTAPDEVIHDLIM
NARDSEGYSDSKGIFSARKAIMQYCQLKKFPNVDIDDIYLGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGNAVHYICDEAAEWHPDIDDIKSKITSNTKAIVLINPNNP
TGSLYPKELLLEIIEIARQNDLIIFADEIYDRMVMDGHVHTPVASLAPDLFCVSMNGLSK
SHRIAGFRVGWMVLSGPKTHVKGYIEGLNMLSNMRLCSNVLAQQVVQTSLGGHQSVDELL
LPGGRIYEQRNFIYHAIQEIPGLSAVKPKAGLYIFPKIDRNMYRIDDDEQFVLDFLKQEK
VLLVHGRGFNWQEPDHFRIVYLPRVEELAQIQEKMTRFLKQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatataacaagtctagtaagttagagcatgttgcttatgatatccgtggtccg
gttttggaagaagccatgcggatgcgagcaaatggagaaaagattttacgtctgaataca
ggaaatccagcagaatttggttttacagcgccagatgaggtcattcatgacttgattatg
aatgcgcgtgatagtgaaggatattctgactccaaagggattttttcagcccgtaaggcc
atcatgcagtactgccaactgaagaaattcccaaacgtagatattgatgatatttacctt
ggaaatggtgtcagtgagctgattgtcatgtccatgcaggggcttttggacaatggagac
gaggtcttggtgccaatgccagactatcctctctggacggccgctgtcagcctagctggt
ggaaatgccgttcactatatctgtgatgaagctgcagaatggcacccagatattgacgat
atcaagtcaaaaatcacttccaataccaaggcaatcgtccttatcaatccaaacaaccca
actggatccctttatcctaaggaactcttgttggagattattgagattgcccgtcaaaac
gatttgattatctttgcggatgaaatttacgaccgcatggtcatggatggacatgtgcat
acgcctgtggcgagtttggcaccggatctcttctgtgtcagcatgaatggtctgtcaaaa
tcgcatcgtatcgctggtttccgtgtgggttggatggtcttgtctggccctaagactcat
gttaagggctatatcgaagggctcaatatgctgtccaatatgcgcctttgctctaacgtt
ttggcccaacaagtcgtccaaacctccttaggtggtcaccaatcagtcgatgaattgctc
cttcctggtggacggatttatgaacaaagaaacttcatctaccatgccattcaagagatt
ccaggtttgtctgccgttaaacccaaggcgggtctctatatctttcccaaaatcgaccgc
aatatgtaccgtatcgatgatgatgagcagtttgtccttgatttcttgaagcaggaaaag
gtgctcttggttcatggtcgaggctttaactggcaggaaccagaccacttccgtatcgtt
taccttcctcgtgtcgaggaactagcccaaatccaagaaaagatgactcgtttcttaaaa
cagtatcgcagatag

DBGET integrated database retrieval system