KEGG   Stenotrophomonas sp. KCTC 12332: AXG53_03980Help
Entry
AXG53_03980       CDS       T04408                                 

Definition
(GenBank) peptidase M20
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
stek  Stenotrophomonas sp. KCTC 12332
Brite
Enzymes [BR:stek01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     AXG53_03980
Peptidases [BR:stek01002]
 Metallo Peptidases
  Family M2
   AXG53_03980
Exosome [BR:stek04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AXG53_03980
CD molecules [BR:stek04090]
 Proteins
  AXG53_03980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
893937..895964
Genome map
AA seq 675 aa AA seqDB search
MKNRHLVLAAAVGVAVLSLAACKKDAATDAAKPATTQTAPAESADQFIARVNAEYKAMYP
EMTSAQWLSSTYINDDSARVAAKANERWLTVLNGWIEQANKYEGQPMSADTKRAISLLKL
MTSMPAPRDPQKLAELAGIATKLEGDYGAGTYCVGEGDKQNCRQLGDLEKVLATSRDYDK
QLDAWQGWQSTAVPSRANYQRFVELVNEGARELGYTDAGQMWRSGYDMPADQVGPETDRL
WGQLKPLYEQLHCYTRAKLDKEYGKDKAEVGGGMIAAHLTGNMWQQDWSNLWDMTAPYPN
AGSLDITAALEKQYQTNLSGALAKAGGSDPASRFKAQREAELATAKQMTERAQDFYVSLG
MPKLPDSYWQNTQFIKPLDRNVVCHASAWDMNMGGDGKDVGPDVRTKMCITPNEENFTTI
YHELGHIYYDLAYNPLPPLFQGGANDGFHEAIGDTIVLAMTPKYLNSIGLVDAQQESREA
TINAQMRMAMSGVSFLPFGLMIDRWRWGVFDGSIKPDQYNQKWWELKAQYQGVAPASARG
EEFFDAGAKYHVPGNTPYLRYFLARVLQYQFYKGLCDASGYTGPLNECSFYGNKEAGQKF
WAMLSKGASQPWQATLKELTGTEKLDAAPMLEYFSPLQEWLKQQNEGQMCGWQAAAPAAA
PTAAPAAAPAQPSAP
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaatcgtcatttggtcctggccgccgccgtcggcgtggccgtgctctcgttggct
gcctgtaaaaaggacgccgccaccgacgccgccaagccggccaccacccagaccgcaccg
gccgaaagcgccgaccagttcattgcccgggtcaatgccgaatacaaggccatgtacccg
gagatgacctcggcgcagtggctgtcgtccacctatatcaacgacgattcggcacgcgtc
gcggccaaggccaacgagcgctggctgaccgtgctgaacggctggatcgagcaggccaac
aagtacgaaggccagccgatgagtgccgataccaagcgcgccatcagcctgctcaagctg
atgacctcgatgcccgccccgcgtgacccgcagaagctggccgagctggccggcatcgcc
accaagctggaaggcgactacggcgccggcacctattgcgtgggtgaaggcgacaagcag
aactgccgccagcttggcgacctggagaaggtattggccacgtcgcgcgactacgacaag
caactcgacgcctggcagggctggcagtccaccgccgtgccgtcgcgtgccaactaccag
cgcttcgtcgaactggtcaacgaaggcgcacgcgaactgggttacaccgatgccggccag
atgtggcgcagcggctacgacatgccggccgaccaggttggcccggaaaccgaccgcctg
tggggccagctcaagccgctctacgaacaactgcactgctacacccgcgccaagctggac
aaggaatacggcaaggacaaggccgaagtgggcggcggcatgatcgccgcgcacctgacc
ggcaacatgtggcagcaggactggagcaacctgtgggacatgaccgcgccgtacccgaac
gcgggcagcctggacatcaccgccgcgctggaaaaacagtaccagaccaatctgagcggt
gccctggccaaggccggcggcagcgacccggccagccgcttcaaggcgcagcgtgaagcc
gagctggccaccgccaagcagatgaccgagcgcgcgcaggacttctacgtgtcgctgggc
atgcccaagctgccggacagctactggcagaacacccagttcatcaagccgctggaccgc
aacgtggtctgccacgccagcgcctgggacatgaacatgggcggtgacggcaaggatgtt
ggcccggacgtgcgcaccaagatgtgcatcaccccgaacgaagaaaacttcaccaccatc
taccacgagctcggccacatctattacgacctggcctacaacccgctgccgccgttgttc
cagggcggtgccaacgacggcttccacgaagccatcggcgacaccatcgtgctggcgatg
acgcccaagtacctcaactcgatcggtctggtcgatgcgcagcaggaaagccgcgaagcc
accatcaatgcgcagatgcgcatggcgatgtcgggcgtgtcattcctgccgttcgggctg
atgatcgaccgctggcgctggggcgtgttcgatggctcgatcaagccggaccagtacaac
cagaaatggtgggaactgaaggcccagtaccagggcgtggccccggccagcgcccgcggc
gaggagttcttcgacgccggtgccaagtaccacgtaccgggtaacacgccgtacctgcgc
tacttcctggcgcgcgtgttgcagtaccagttctacaagggcctgtgcgacgcatccggc
tataccggcccgctcaacgagtgcagcttctatggcaacaaggaagccggccagaagttc
tgggccatgctgagcaagggcgccagccagccgtggcaggccacgctgaaggaactgacc
ggcaccgagaagctcgacgccgcgccgatgctggaatacttctccccgctgcaggaatgg
ctgaagcagcagaacgaaggccagatgtgtggttggcaggctgcagctcctgctgcggca
ccgaccgctgctccagcagctgcaccggcgcagccatcggcaccgtaa

DBGET integrated database retrieval system