KEGG   Streptococcus pyogenes MGAS15252 (serotype M59): MGAS15252_1084Help
Entry
MGAS15252_1084    CDS       T01794                                 

Gene name
sodA
Definition
(GenBank) manganese superoxide dismutase protein SodA/SodM
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
stg  Streptococcus pyogenes MGAS15252 (serotype M59)
Brite
Enzymes [BR:stg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MGAS15252_1084 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1077357..1077962)
Genome map
AA seq 201 aa AA seqDB search
MAIILPELPYAYDALEPQFDAETMTLHHDKHHATYVANTNAALEKHPEIGENLEELLADV
TKIPEDIRQALINNGGGHLNHALFWELLSPEKQDVTSDVAQAIDDAFGSFDAFKEQFTAA
ATGRFGSGWAWLVVNKEGQLEITSTANQDTPISEGKKPILALDVWEHAYYLNYRNVRPNY
IKAFFEIINWKKVSELYQAAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggctattattttaccagaacttccatacgcgtatgatgctcttgaaccacagtttgat
gcggagacaatgactcttcatcatgataaacaccatgccacttatgtcgctaataccaat
gcggctttagaaaaacacccagagatcggagaaaatctggaggaactattggcagatgtc
actaagattccagaagatattcgtcaagccttaattaataatggtggcggacacctaaac
catgcgcttttctgggaactattatcacctgaaaaacaagacgtcacttctgatgttgca
caagccattgatgatgcttttgggtcatttgacgcctttaaagaacaatttacagcagct
gctactggacgttttggttcaggttgggcatggttagttgttaataaagaaggacaactc
gaaatcacatcaaccgctaaccaagatactccaatttcagaaggcaaaaaaccaattcta
gcgcttgatgtgtgggagcatgcttactacttgaattatcgtaatgtacgtccaaattat
atcaaagctttctttgaaatcattaattggaaaaaagtatcagaactttaccaagccgct
aaataa

DBGET integrated database retrieval system