KEGG   Streptococcus thermophilus ASCC 1275: T303_04825Help
Entry
T303_04825        CDS       T03360                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sthe  Streptococcus thermophilus ASCC 1275
Brite
Enzymes [BR:sthe01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     T303_04825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIC24244
LinkDB All DBs
Structure
PDB: 

Jmol
Position
878230..878892
Genome map
AA seq 220 aa AA seqDB search
MKALSLYGKMEKNEKRTFTMAIILPDLPYAYDALEPYIDAETMTLHHDKHHATYVANANA
ALEKHPEIGEDLEALLADVEKIPADIRQALINNGGGHLNHALFWELLSPEKQEPTAEVAA
AINEAFGSFEAFQEVFTTAATTRFGSGWAWLVVNAEGKLEVVSTPNQDTPISDGKKPILA
LDVWEHAYYLKYRNVRPNYIKAFFEIINWNKVAELYAEAK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagctctatcactttatggtaagatggaaaaaaatgaaaagaggacctttactatg
gctattattcttccagatcttccttacgcttacgatgctttggaaccatacattgatgct
gaaacaatgactcttcatcatgacaaacaccatgcaacttacgtggcgaatgctaatgct
gcgcttgaaaaacaccctgaaattggtgaggaccttgaagcgcttttggctgatgtagaa
aaaattccagcagacattcgtcaagcacttattaacaatggtggtggacatcttaaccac
gcacttttctgggaacttttgtcaccagaaaaacaagaaccaactgcagaagtagcagcc
gctattaacgaagcattcggttcatttgaagctttccaagaagttttcactacggcagcg
acaactcgttttggttcagggtgggcatggcttgtggttaacgcagaaggtaaacttgaa
gttgtttcaactcccaaccaagatacacctatctcagacggtaaaaaaccaatcttggca
cttgatgtttgggaacatgcttactacctaaaataccgtaacgtacgtccaaactacatc
aaagccttctttgaaatcatcaattggaataaagttgctgagctttacgcagaagctaaa
taa

DBGET integrated database retrieval system