KEGG   Streptococcus thermophilus S9: AVT04_01330Help
Entry
AVT04_01330       CDS       T04785                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sths  Streptococcus thermophilus S9
Brite
Enzymes [BR:sths01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AVT04_01330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(251323..251928)
Genome map
AA seq 201 aa AA seqDB search
MAIILPDLPYAYDALEPYIDAETMTLHHDKHHATYVANANAALEKHPEIGEDLEALLADV
EKIPADIRQALINNGGGHLNHALFWELLSPEKQEPTAEVAAAINEAFGSFEAFQEVFTTA
ATTRFGSGWAWLVVNAEGKLEVVSTPNQDTPISDGKKPILALDVWEHAYYLKYRNVRPNY
IKAFFEIINWNKVAELYAEAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggctattattcttccagatcttccttacgcttacgatgctttggaaccatacattgat
gctgaaacaatgactcttcatcatgacaaacaccatgcaacttacgtggcgaatgctaat
gctgcgcttgaaaaacaccctgaaattggtgaggaccttgaagcgcttttggctgatgta
gaaaaaattccagcagacattcgtcaagcacttattaacaatggtggtggacatcttaac
cacgcacttttctgggaacttttgtcaccagaaaaacaagaaccaactgcagaagtagca
gccgctattaacgaagcattcggttcatttgaagctttccaagaagttttcactacggca
gcgacaactcgttttggttcagggtgggcatggcttgtggttaacgcagaaggtaaactt
gaagttgtttcaactcccaaccaagatacacctatctcagacggtaaaaaaccaatcttg
gcacttgatgtttgggaacatgcttactacctaaaataccgtaacgtacgtccaaactac
atcaaagccttctttgaaatcatcaattggaataaagttgctgagctttacgcagaagct
aaataa

DBGET integrated database retrieval system