KEGG   Streptococcus thermophilus S9: AVT04_01340Help
Entry
AVT04_01340       CDS       T04785                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sths  Streptococcus thermophilus S9
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sths00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AVT04_01340
  Energy metabolism
   00680 Methane metabolism
    AVT04_01340
Enzymes [BR:sths01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AVT04_01340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(253125..255947)
Genome map
AA seq 940 aa AA seqDB search
MAFNKLESSNNQEIISEEVGILKELLDDATRGMAGEQGLTTIQHLVELYDEGDYEALTQA
ISEMTNDDMVFASRYFSLLPLLINISEDVDLAYEVNRKNNIDESYLGKLSETFDVVAESD
NARDILENVNVVPVLTAHPTQVQRKTMLELTNHIHELLRKHRDVKDGLINKDKWYADLRR
YVEIMMKTDIIREKKLKVKNEITNVMEYYNSSLIKAITKLSHEFKRLAVEKGIELDNPTP
ITMGMWIGGDRDGNPFVTAETLKLSATLQSEVILNYYIEKVDNLYRSFSLSSRLTEVSET
VAEMAKLSPDTSVYRENEPYRRAFSYIQSKLIQTLLFFKAGNFSNERAAKRLSENVRLGS
VSTGEVVADFVHDRLSQSLQAVSQQTTEFYETAEAFHDDLLAIKNSLLENDDSVLISGDF
EELLQAVEVFGFYLATIDMRQDSSVHEACVAELLKSANIVDNYSELTEVEKVAVLLKELQ
EDPRTLSSTNVSKSETLEKELAIFRTARLLKDYLGEEVIKQHIISHTESVSDMFELAILL
KEVGLVDTERARVQIVPLFETIEDLENSNEIMKQYLGYDIVKRWIKNSNNYQEIMLGYSD
SNKDGGYLSSGWTLYKAQNELTNIGEERGIKITFFHGRGGTVGRGGGPSYDAITSQPFGT
IKDRIRLTEQGEVIGNKYGNKDAAYYNLEMLVSATLDRMVTRQITDPDELVDFREIMDSI
VQDSNRIYRDLVFGNEHFYDYFFEASPIKEVSSLNIGSRPAARKTITDISGLRAIPWVFS
WSQNRIMLPGWYGVGSAFNHYIEAEEGNLEKLQHMFETWPFFRSLLSNVDMVLSKSDMNI
AFHYAQLAESEEVRSVFNIILDEWQLTKNVILAIEKHDDFLEESPSLKASLGFRLPYFNV
LNYIQIELIKRLRNNNLTDDEISLIHITINGIATGLRNSG
NT seq 2823 nt NT seq  +upstreamnt  +downstreamnt
ttggcttttaacaaattggaaagcagtaacaaccaggaaatcatctctgaagaagttggt
atcttgaaagaattgttggatgatgcaacacgaggcatggctggtgagcaaggcctcacg
actatccaacatttggttgaactttatgatgaaggtgactatgaggcccttacacaagcc
atttcagaaatgacaaatgatgatatggtctttgcatcacgttatttctctttgttacct
ctcttgattaatatctctgaggacgtggatttggcttatgaagtcaaccgcaaaaataat
attgatgaatcttatttaggtaagttgtctgaaacctttgatgttgtcgctgaaagcgac
aatgcgcgtgacattcttgaaaatgttaatgtcgtgccggtattgacagctcacccaact
caggttcaacgtaaaaccatgcttgaattgactaaccacattcacgaacttctccgtaag
catcgtgacgttaaggatggtcttattaataaggataaatggtatgcggatttgcgtcgt
tatgtagagattatgatgaaaacggatatcattcgtgagaagaaacttaaagttaaaaac
gaaatcactaacgttatggagtattacaactcctcattgattaaggcgattaccaagcta
tcgcatgaattcaaacgtttagcggttgaaaaaggtatcgaacttgataatccaacacct
attacaatgggaatgtggattggtggtgaccgtgacgggaacccatttgtaacggcagaa
actcttaaactttctgcgacattacaaagtgaagttatcctcaattactatattgaaaaa
gttgataatctttaccgctcattctcactctcatcacgtttgactgaagtttcagaaaca
gtagcagaaatggcgaaactttctccagatacatctgtctaccgtgaaaacgaaccatac
cgtcgtgcttttagttacattcaatctaaattgattcagacgcttcttttcttcaaagca
ggtaactttagcaatgaaagagctgctaagcgtctttctgaaaatgttcgtcttggctca
gtctcaacaggtgaagtagtagctgattttgtgcatgaccgtctcagccaaagtcttcaa
gctgtctcacaacaaactaccgaattttatgaaacagctgaagcattccatgatgatctt
ttggcaattaaaaattcacttctcgaaaatgatgattctgtcttgatttccggtgatttc
gaagagcttcttcaagctgttgaggtctttggattctaccttgcaacaattgatatgcgt
caggattcaagcgttcatgaagcttgtgtggcagagttgcttaaatctgcaaacattgtt
gacaactacagtgaattgacagaggttgaaaaggttgctgttcttcttaaagaattgcaa
gaagatccacgtaccttatcatcaacaaatgtatctaagtctgaaacgcttgaaaaagaa
ttagctatcttccgtactgctcgtcttttgaaggactatcttggtgaagaagtcatcaaa
caacatatcatctctcacactgagagcgtctcagatatgtttgagttagccatccttctt
aaagaagttggtttagttgatactgagcgtgcgcgtgtccaaatcgttccactgtttgaa
accatcgaagacttggaaaactctaatgaaatcatgaaacaataccttggttatgatatt
gttaaacgatggattaagaatagcaataactaccaagaaatcatgttgggttactcagat
tcaaacaaagatggtggttacttgtcttcaggttggacgctttacaaggctcagaacgaa
ttgaccaatattggtgaagagcgtggcattaaaattaccttcttccatggccgtggtggt
acagttggtcgtggtggtggcccatcttacgatgctattacttctcaaccatttggtact
attaaagaccgtatccgtttgacggagcaaggtgaggttatcggtaataaatatggcaat
aaggatgcagcttactacaatcttgaaatgctagtttcagctacgcttgatcgcatggta
acacgccaaattactgatcctgatgaattggttgatttccgtgaaattatggatagtatt
gttcaagattctaatcgtatttatcgagatcttgtcttcggaaatgaacatttctatgat
tacttctttgaagcaagtccaatcaaggaagtatcaagtttaaatattggttctcgtcca
gctgctcgtaagactattactgatatttcaggacttcgtgctattccttgggtattctca
tggtcacaaaaccgtatcatgttaccaggttggtatggtgtgggttctgcctttaatcac
tatattgaagctgaagaaggaaaccttgaaaaacttcaacacatgtttgaaacatggcca
ttcttccgttcacttttgtctaacgtggatatggtgctttcaaaatcagatatgaatatt
gccttccactatgcacagttggcagagagtgaagaagttcgtagcgtctttaacatcatt
ttggatgagtggcagctgactaagaatgtcattcttgcgattgaaaaacatgatgacttc
cttgaagaaagcccatctcttaaagcgagtttgggtttccgattgccatacttcaacgtc
ttgaactacatccaaattgaattgattaaacggcttcgtaataataatctgactgatgac
gaaattagtcttattcatattactatcaatggtattgcaacaggacttcgaaactctggt
taa

DBGET integrated database retrieval system