KEGG   Sphaerobacter thermophilus: Sthe_1825Help
Entry
Sthe_1825         CDS       T01128                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sti  Sphaerobacter thermophilus
Brite
Enzymes [BR:sti01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Sthe_1825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1:2009417..2010028
Genome map
AA seq 203 aa AA seqDB search
MAYQAIELPYAYNALEPHIDEATMRYHHDNHYMTYVNNYNNAIKGHSNLQNMSAEDVLRN
INQVPEDIRTAVRNNGGGAVNHTMFWEIMGPNKGGEPTGELADAIKQAFGDFASFKDEFT
KAALGRFGSGWAWLVWRNGKLEVMSTANQDSPLMDGLYPIMGLDVWEHAYYLKYQYRRPA
YVEAWWNVVNWDEVAKRFATARS
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcctaccaggcgatcgagttgccctacgcgtacaacgcgctggagccgcatatcgac
gaagcgaccatgcgctaccaccacgacaaccactacatgacctatgtcaacaactacaac
aacgccatcaagggccactccaacctgcagaacatgagcgccgaggatgttctgcgcaac
atcaaccaggtgccggaggacatccgcactgccgtccgcaacaacgggggcggtgcggtc
aaccacaccatgttctgggagatcatgggcccgaacaagggtggcgagccgaccggtgag
cttgcggacgccatcaagcaggcgttcggtgacttcgcctccttcaaggacgagttcacc
aaggcagccctcgggcgcttcggcagcggctgggcctggctggtatggcgcaacggcaag
ctcgaggtcatgagcacggcgaaccaggacagccccttgatggacggcctctacccgatc
atgggcctggacgtctgggagcatgcctactacctcaagtaccagtaccgccgcccggcc
tacgtcgaggcctggtggaacgtggtcaactgggacgaggtcgccaagcgcttcgccacc
gcccgcagctag

DBGET integrated database retrieval system