KEGG   Streptococcus parauberis: STP_0952Help
Entry
STP_0952          CDS       T01504                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
stk  Streptococcus parauberis
Pathway
stk00010  Glycolysis / Gluconeogenesis
stk00020  Citrate cycle (TCA cycle)
stk00620  Pyruvate metabolism
stk01100  Metabolic pathways
stk01110  Biosynthesis of secondary metabolites
stk01120  Microbial metabolism in diverse environments
stk01130  Biosynthesis of antibiotics
stk01200  Carbon metabolism
Module
stk_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:stk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STP_0952
   00020 Citrate cycle (TCA cycle)
    STP_0952
   00620 Pyruvate metabolism
    STP_0952
Enzymes [BR:stk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     STP_0952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 PYNP_C PLA2_B HlyD_3
Motif
Other DBs
NCBI-ProteinID: AEF25400
LinkDB All DBs
Position
complement(1011805..1013217)
Genome map
AA seq 470 aa AA seqDB search
MAAEIIMPKLGVDMQEGEIIEWKKQEGDSVNEGDILLEIMSDKTNMEIEAEDAGILLKIV
RPAGDVVPVTEVIGYIGAEGESVENIASSEKTTEIPVPNSADAAPTVAPKEDVERPEITV
ETALPQGNGEKVRATPAARKTASEMGVSLGQVPGSGPKGRVHQEDVENFKNAQPKASPLA
RKMAEDAGLNLADITGTGFNGKVMKEDILATIKASKPAEEVVAKPAKGEKAKAELPEGVE
VIKMSAMRKAISKGMTNSYLTAPSFTLNYDIDMTEMMSLRKKLIDPIMEKTGLKVSFTDL
IGMAVVKTLMKPEHQYMNASLINDAQEIELHKFVNIGIAVGLDDGLIVPVVHNADKMSLA
DFVVASKDVIKKTQQGKLKAAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVGATIP
TPTVVNGEIVPRPIMAMCLTIDHRLVDGMNGAKFMVDLKNLMENPFGLLI
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgaaattattatgcctaaactcggtgttgatatgcaagaaggcgaaatcatc
gagtggaaaaaacaagaaggcgatagtgtcaatgaaggtgatattcttctagaaattatg
tctgacaagactaatatggagattgaggctgaagatgctggtatcttgttgaaaattgtt
cgtcctgcaggagatgttgttcctgtaactgaagttattggttatattggtgctgaaggt
gaatcagttgagaatattgcttcaagtgaaaaaacaactgaaatccctgttccaaattcg
gcagatgctgccccaacggtagcacctaaagaagatgttgaaagacctgaaataactgta
gaaactgctctccctcaaggaaatggcgaaaaagttcgtgcgacacctgctgcccgtaaa
acagcttctgaaatgggtgtctcacttggtcaagttcctggttcaggacctaaaggtcgt
gttcatcaagaagatgttgaaaacttcaaaaacgctcaacctaaagcctcaccacttgct
cgtaaaatggcagaggatgctggtctcaacttagctgatatcactggtactggatttaat
ggtaaagtgatgaaagaagatatcttagctacaatcaaagcatctaaaccagctgaagaa
gttgttgctaaaccggcaaaaggagaaaaagcgaaagctgaacttcctgaaggtgttgaa
gttatcaagatgtctgcaatgcgtaaagcaatctctaaaggtatgactaactcttaccta
acagctccgtcattcacattgaactatgatattgatatgactgagatgatgtctcttcgt
aaaaaattaattgacccaatcatggaaaaaactggtttgaaagtaagttttactgactta
attggtatggctgttgttaaaacattgatgaaaccagaacatcaatacatgaatgcttca
ttaatcaatgacgctcaagaaattgaattacacaaatttgtaaatattggtattgccgtt
ggtcttgatgatggattaattgtaccagtagttcacaatgcagataagatgtcacttgct
gatttcgttgttgcatcaaaagatgtcattaagaaaactcagcaaggtaaattaaaagct
gctgaaatgtcaggttcaacattctctattacaaatttaggtatgtttggtactaaaaca
tttaaccctatcattaaccaaccaaactcagcaatcttaggtgttggagcaactattccg
acaccaactgtagttaatggtgaaatcgttcctcgtccaatcatggcaatgtgtttaaca
attgaccatagacttgttgatggcatgaacggtgctaaattcatggttgatcttaaaaac
ttaatggaaaatccatttggactattaatctga

DBGET integrated database retrieval system