KEGG   Salinispora tropica: Strop_2001Help
Entry
Strop_2001        CDS       T00504                                 

Definition
(GenBank) Alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
stp  Salinispora tropica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Strop_2001
Enzymes [BR:stp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Strop_2001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(2271513..2273282)
Genome map
AA seq 589 aa AA seqDB search
MLTTLGPHRWRRRAAGLLAAALVTAITAITATSLPANVQASPPGDRDVTAVLFEWRFDSI
ARACQDTLGPKGYGFVQVSPPQEHIQGWQWWTSYQPVSYDISSRLGDRNAFRAMTEACHG
AGVKVIVDAVINHMTAGSGTGTGGTNYNKYDYPGFYQVQDFHSCRKHISDYRNRYDVQEC
ELLGLADLNTGSDYVRGRIAGYLNDLLSLGADGFRIDAAKHIAASDLAAIRSRMSNPNAY
WIQEVIYGAGEAVQPSEYLGTGDVQEFRYARDLKRVFQNEKLAYLRNYGEGWGYLSSGKA
GVFVNNHDTERNGETLSYKNGSDYTLANVFMLAWPYGTPHVHSGYEFSDRDAGPPNGGHV
NACYSDGWTCQHAWRQIANMVGFRNAAAGTGVTNWWDNGNDQIAFGRGDRAFVAINQEGG
TLTRTFQTSLPAGTYCDVQHGDPTTSGGCTGPTYTVNSSGQFAASIGPGDAVALYRGAAG
SPTPDPSQSPSDRVNVTFAVTATTVWGQNIFVVGDHPDLGSWNPDRALPMSAASYPQWRL
TTPLPSGSAIQYKYIRKESNGHVTWESGNNRTATIPNSGTLTLTDNWRN
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaccacgctcggtccacaccgctggcgtcggcgtgcagccggcctcctcgccgcc
gctctcgtcaccgccatcaccgccatcaccgccacctcgctgccggccaacgttcaggcg
tcgccgccgggcgaccgggacgtcaccgccgtcctgttcgagtggcgcttcgactcgatt
gcccgcgcctgccaggacacactggggcccaagggatacggcttcgtgcaggtctcccca
ccgcaggagcacatccagggctggcagtggtggacgtcgtaccaacccgtcagctacgac
atctccagccggctgggtgaccggaacgcgttccgggccatgaccgaggcctgccacggc
gccggagtgaaggtcatcgtggacgcggtcatcaaccacatgaccgcaggatccggcacc
ggcaccggcggcactaactacaacaagtacgactacccaggcttctaccaggtccaggac
ttccactcctgccgcaaacacatcagcgactaccgcaaccgctacgacgtccaggagtgt
gaactgctcggcctggccgacctgaacaccgggtccgactacgtacgggggcgtatcgct
ggctacctcaacgaccttctctccctcggcgcggacggcttccgcatcgacgcggccaag
cacatcgccgccagcgacctggcggcgatccgctcccggatgagcaaccccaacgcctac
tggatccaggaagtgatctacggtgccggtgaggcggtccagcccagcgagtaccttggc
acgggcgacgtgcaggagttccgctacgcgcgggacctgaagcgggtgttccagaacgag
aagctggcctatctgcgcaactacggcgaaggttggggctacctgtccagcggcaaggcc
ggcgtcttcgtcaacaaccacgacaccgaacgcaacggcgagaccctctcctacaagaac
ggctccgactacacgctcgccaacgtgttcatgctcgcctggccgtacggcacgccgcac
gtgcactccggctacgagttcagcgaccgggacgccggcccacccaacggcggccacgtc
aacgcctgctactccgacgggtggacgtgtcaacacgcctggcgccaaatagccaacatg
gtgggcttccgcaacgccgccgccgggaccggtgtgacgaactggtgggacaacggcaac
gaccagatcgcgttcggccgcggtgaccgtgccttcgtcgccatcaaccaggaaggcggc
accctcacccgaaccttccagacgtcactgcccgccggcacctactgcgacgtgcagcac
ggcgacccgaccacgagcggtggatgcaccggccccacctacacggtcaactcctcgggc
cagttcgccgcgagcatcggcccgggtgacgcggtcgccctctaccgcggcgccgcgggc
agcccgactccggacccgtcccagtccccgtcggatcgcgtcaacgtcacgttcgcggtc
accgccaccaccgtctgggggcagaacatcttcgtcgtcggtgaccaccctgacctcggc
tcatggaaccccgaccgcgccctgccgatgagcgccgccagctacccccagtggcggctg
accactcccctgcccagcggcagcgccatccagtacaagtacatccgcaaggagtccaac
ggtcacgttacctgggaaagcggcaacaaccggaccgccacgatcccgaacagcggaaca
ctgaccctgaccgacaattggcgaaactga

DBGET integrated database retrieval system