KEGG   Salinispora tropica: Strop_2993Help
Entry
Strop_2993        CDS       T00504                                 

Definition
(GenBank) aminotransferase
Organism
stp  Salinispora tropica
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(3424113..3425423)
Genome map
AA seq 436 aa AA seqDB search
MTTDDLLARHRAVLPSWMPLYYDEPIELVAGQGRRVTDAQGRTYLDFFGGVLTNSIGYDI
PEIRAAVERQLRTGIVHTSTLYLIRQQVELAEKVARLSGIPDARVFFTNSGTEANEAALL
MATNHRRSQQILAVRNSYHGRSYATIGVTGNRGWSASPLNPLQVAWLHSGERLRGLLARL
PEADRIDAAVEDLREVLATQTSGDVACLIAEPIQGVGGFVHGPDGLLAGWRKVLDEHGIL
LISDEVQTGWGRTGTHFWGYQAHGVTPDMITFAKGIGNGFALAGVVGRAAVVESVPAISF
STFGGNPLSAAAGNAVLDYLLDNDLQANADRVGMILHEGLRAEVGGLPGVAEVRGKGLML
GVEFVHPGTIDPDPKRAAQVFEACRAGGLLVGKGGLYGNVVRMGPPLTLTEEEAREGLAI
LVTAIRSGGTAPTVAA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgacgatctgctggcccgacaccgggcggtgctcccgtcctggatgccgctc
tactacgacgaaccgatcgaactcgtcgctggccaggggcgccgggtcaccgatgcgcag
ggccgcacctacctggacttcttcggcggcgtcctgaccaacagcatcggttacgacatc
ccggagatccgcgcggcggtggagcgccagttgcgtaccgggatcgtgcacacctcgacg
ctctacctgatccgacagcaggtggagctggccgagaaggtggcccggctgtccggaatt
ccggacgcgcgggtcttcttcaccaactccggcaccgaggccaacgaggcagcgttgctg
atggccaccaaccatcggcgctcgcagcagatcctcgccgtgcgcaacagctaccacggc
cggtcgtacgcgacgatcggggtcaccggcaaccgtggttggtcggcgagtccgctgaac
ccgttgcaggtggcctggctgcactcgggggagcggctgcggggcctgctcgcccggcta
cccgaggccgatcggatcgacgcggcggtggaggatctgcgggaggtcctggccacccag
acctcgggtgatgtcgcctgcctgatcgccgagccgattcagggcgtcggcggcttcgtc
cacggcccggacgggctgctcgccggctggcgcaaggtgcttgacgagcacggcatcctg
ctcatctcagacgaggtgcagaccggctgggggcgtaccggcacgcacttttggggttac
caggcccacggggtgaccccagacatgatcacctttgccaagggcatcggcaacgggttc
gcgctcgccggcgtggtcgggcgggccgcggtggtggagtcggtgccggcgatcagcttc
tccaccttcggcggcaacccgctctccgccgccgccggcaacgccgtgctcgactacctg
ctcgacaacgacctgcaggccaacgcggaccgggtgggcatgattctccacgaggggctt
cgcgccgaggtcggtgggctccccggggtcgccgaggtacgcggcaagggactgatgctc
ggcgtcgagttcgtccacccaggcaccattgatccggatccgaagcgagccgcccaggtg
ttcgaggcgtgccgggccggtggtctgctcgtcggcaagggcggtctgtacgggaacgtg
gtgcggatgggcccaccgttgaccctgaccgaggaggaggcccgggagggcctggcaatt
ctggtgactgcgatccgatccggcgggaccgcgccgacggtggcggcatga

DBGET integrated database retrieval system