KEGG   Streptomyces sp. CNQ-509: AA958_00730Help
Entry
AA958_00730       CDS       T03968                                 

Definition
(GenBank) hypothetical protein
Organism
strc  Streptomyces sp. CNQ-509
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AKH80935
UniProt: A0A0F7MXH6
LinkDB All DBs
Position
243530..245203
Genome map
AA seq 557 aa AA seqDB search
MTPAATIGAALLDLADSDPDRPLAYVEGSGDPVRLTAAELAERAGAAATTLAEHGVRRGD
RVGVCMDTSADAYATLHGCFLLGAIPFVSEPPLATMRRQRWADRLRLLISRAEPRAVVVA
PEFLDAVTEPCKEAGVAIVEPPFEGGLDLAAAQAKPDDIALLQFTSGTTGDSRGVTLTHE
SIFANAAAIGEHAYRAGDLIVSWLPMHHDMGLIGLNLAPLLHGLPVASMPPLSFAVRPER
WLWAMHRYRGTFTSAPNFAYRMCASNIPDAKLAGLDLSAWRVAGNGAEVVQANTLRLFAE
RMAPYGYGERSMMPCYGMAEITLAATMCVPGEPLTTLTVSRDRLAADGEVVEAEPGAADA
QELVSSGTPLTGMELRVVDDAGADLPDRKQGTILLRTASMMSGYYRQPEETAKVLGDDGW
LNTGDQGFTDAGQTYVTGRIKDVVIIAGSNYHPYAFESAAAAVEGLRANSIAAVGCPDEE
RSTEALVLVVESKSHADAEAVAQIREGVIQAVSAETGLRPDRVEVVPRGTLPKTPSGKLQ
RRHVVDALVNGTLPTSH
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgacgccggccgccacgataggcgcggcgctgctcgatctcgcggacagcgaccccgac
cgtccgctggcgtacgtcgagggctcgggcgaccccgtcaggctgaccgcggcggagctg
gccgagcgcgcgggcgccgccgcgaccaccctcgcggagcacggcgtgcggcgcggtgac
cgcgtcggcgtctgcatggacaccagcgccgacgcgtacgccacgctgcacggctgcttc
ctgctgggcgccatcccgttcgtcagcgagccgccgctggcgacgatgcgccggcagcgc
tgggccgaccggctgcggctgctgatcagccgcgccgagccgcgggccgtggtcgtcgcg
ccggagttcctcgacgcggtgacggagccgtgcaaggaggccggcgtcgcgatcgtcgag
ccgcccttcgaaggcggtctcgacctggccgccgcgcaggccaagcccgacgacatcgcg
ctgctgcagttcacctccggcaccacgggcgacagccggggcgtgaccctgacccacgag
tcgatcttcgccaacgccgcggccatcggcgagcacgcctaccgcgccggcgacctgatc
gtgagctggctgcccatgcaccacgacatgggcctgatcgggctgaacctcgcgccgctg
ctgcacgggctgccggtggcgagcatgccgccgctctcgttcgcggtccggcccgagcgg
tggctgtgggcgatgcaccgctaccggggcacgttcacctcggcgcccaacttcgcgtac
cgcatgtgcgcctcgaacatccccgacgccaagctggcgggcctcgacctgagcgcctgg
cgggtcgcgggcaacggcgcggaggtcgtccaggcgaacaccctgcggctgttcgccgag
cgcatggccccgtacggctacggcgagcgttcgatgatgccctgctacggcatggcggag
atcaccctcgccgcgaccatgtgcgtgcccggcgagccgctgaccacgctcaccgtcagc
cgcgaccggctggccgcggacggcgaggtcgtggaggccgagccgggcgccgccgacgcg
caggagctggtctcctccggcaccccgctgacgggcatggagctgcgcgtcgtggacgat
gcgggcgccgacctgccggaccgcaagcagggcaccatcctgctgcgtactgcctcgatg
atgtccggctactaccgccagcccgaggagaccgcgaaggtcctgggcgacgacggctgg
ctgaacaccggcgaccagggcttcaccgacgccgggcagacctacgtcaccggccgcatc
aaggacgtcgtcatcatcgccgggtccaactaccacccgtacgccttcgaatcggccgcc
gccgcggtggaggggctgcgggcgaactccatcgccgccgtgggctgccccgacgaggag
cgcagcacggaggcgctggtgctggtggtggagtcgaagagccacgcggacgccgaggcc
gtcgcccagatccgcgagggcgtcatccaggcggtctccgccgagacggggctgcgcccc
gaccgggtggaggtcgtgccgcggggcacgctgcccaagaccccgagcggcaagctccag
cggcgccacgtggtggatgcgctcgtcaacggcacgctgccgacgagccactga

DBGET integrated database retrieval system