KEGG   Streptomyces sp. CNQ-509: AA958_08240Help
Entry
AA958_08240       CDS       T03968                                 

Definition
(GenBank) aldose epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
strc  Streptomyces sp. CNQ-509
Pathway
strc00010  Glycolysis / Gluconeogenesis
strc00052  Galactose metabolism
strc01100  Metabolic pathways
strc01110  Biosynthesis of secondary metabolites
strc01120  Microbial metabolism in diverse environments
strc01130  Biosynthesis of antibiotics
Module
strc_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:strc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AA958_08240
   00052 Galactose metabolism
    AA958_08240
Enzymes [BR:strc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     AA958_08240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AKH82222
UniProt: A0A0F7N5X8
LinkDB All DBs
Position
1985696..1986886
Genome map
AA seq 396 aa AA seqDB search
MTQDRAPLAATSATSRRTLLAATAGGLAAAGLAAPAAAETAGRPRKPVREPFGTLADGTR
VDRWTLSNGGTRLGVLSYGGIVQSLEVPDRHGRYANVSLGFGDLGDYVALSPYFGALIGR
YGNRIAAGRFALDGRTYQLPLNDGDHSLHGGDKGFDKRVWDVEPFTSAAGVGLTLRYVSG
DGEMGYPGALTTRVDYTLTAGGDWRIDYAATTSAPTVVNLTSHVYFNLAGEGSGDVYGHE
LRIAASRYTPVDAGLIPTGELAPVARTPFDFRRAKTIGADLRDDHEQLLYGKGIDHNLVL
DKGITRAPERVATVREPSSGRTMSIATTEPGLQFYSGNFLDGSFTGTSGRVYRQGDGFCL
ETQHFPDSPNQPSFPSTVLRPGDTYRSTTVHSFGTD
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggaccgagccccgctcgccgcgacttcggcgaccagcagacggacgttactc
gccgccactgccgggggcctcgccgccgccggcctggcggcccccgccgcggcggagacc
gcgggccgcccccgcaagccggtgcgcgagcccttcggcacgctggccgacggcacccgc
gtggaccgctggacgctgagcaacggcggcacccggctcggagtgctgtcgtacggcggc
atcgtgcagtccctggaggtgcccgaccggcacgggcggtacgccaacgtgtcgctcggc
ttcggcgacctcggcgactacgtcgccctgagcccgtacttcggcgcgctcatcggacgc
tacggcaaccgcatcgccgcaggccgcttcgcactcgacggccggacctaccaactgccg
ctcaacgacggcgaccacagcctccacggcggcgacaagggcttcgacaagcgggtgtgg
gacgtcgagccgttcacctccgccgcgggcgtgggtctgacgctgcgctacgtcagcggc
gacggcgagatggggtacccgggcgcgctgaccaccagggtcgactacaccctcaccgcg
gggggcgactggcgcatcgactacgccgccaccacctccgcgccgacggtcgtcaacctc
accagtcacgtctacttcaacctcgccggcgagggcagcggcgacgtctacggccacgag
ctgcggatagcggcctcccgctacacccccgtcgacgccggtctcatacccaccggtgaa
ctggccccggtcgcccgcacccccttcgacttcaggcgcgcgaagacgatcggcgcggac
ctgcgcgacgaccacgagcaactgctctacggcaagggcatcgaccacaacctggtcctg
gacaagggcatcacccgcgcccccgaacgcgtcgccacggtccgggagccgtcctcgggc
cgcacgatgagcatcgccaccaccgagcccggtctgcagttctacagcggcaacttcctc
gacggctctttcacgggcacctcgggccgggtctaccgccagggcgacggcttctgcctg
gagacccagcacttccccgactcgccgaaccagccgtcgttcccctccacggtcctccgg
cccggcgacacgtaccgttccaccaccgtgcactccttcggcacggactga

DBGET integrated database retrieval system