KEGG   Streptomyces sp. CNQ-509: AA958_28555Help
Entry
AA958_28555       CDS       T03968                                 

Definition
(GenBank) aminotransferase class III
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
strc  Streptomyces sp. CNQ-509
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:strc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AA958_28555
   00650 Butanoate metabolism
    AA958_28555
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AA958_28555
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AA958_28555
Enzymes [BR:strc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AA958_28555
Amino acid related enzymes [BR:strc01007]
 Aminotransferase (transaminase)
  Class III
   AA958_28555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6648059..6649285
Genome map
AA seq 408 aa AA seqDB search
MALYYAEPIEITHGEGRHVWDAEGNRYLDFFGGILTTMTAHALPEVTKAVAEQAGRILHT
STLYLNRPMVELAERIAQLSGIPDARVFFTTSGTEATDTALLLASTYRRSNQVLAMRNSY
HGRSFTAVGITGNRAWSPTSLSPLQTLYVHGGIRTAGPFADLDDAAFIDACVADLRDMLS
QTRGVAALIAEPVQGVGGFTSPPDGLYAAFREVLAEEGILWITDEVQSGWGRTGDHFWGW
QAHAGNGPPDMLTFAKGIGNGTSIGGVVARAEIMNCLDANSLSTFGGSPVTMAAGLANLG
YVLEHDLQGNARRVGGLLIERLRAAAAGLASVREVRGRGLMIGIELATPGHAAAVLEHAR
AGGLLVGRGKAGETLRIAPPLSLTVAEAEEGAAVLERALHAADAETAG
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggcgctctactacgccgagcccatcgagatcacccacggcgagggccggcacgtctgg
gacgccgagggcaaccgctacctcgacttcttcggcggcatcctcaccaccatgaccgcc
cacgccctcccggaggtcaccaaggcggtcgccgagcaggccggccgcatcctgcacacc
tccaccctctatctcaaccgccccatggtggaactggccgagcgcatcgcgcagttgtcc
ggcatccccgacgcgcgggtgttcttcaccacctcgggcaccgaggccaccgacacggcg
ctgctgctggcgagcacgtaccgccgctccaaccaggtgctggccatgcgtaacagctac
cacggccgctccttcaccgcggtcggtatcaccggcaaccgcgcctggtcgcccaccagc
ctctccccgctgcagaccctctacgtccacggcggcatccgcaccgcgggccccttcgcc
gacctcgacgacgccgcgttcatcgacgcctgcgtcgccgacctgcgcgacatgctctcc
cagacccgcggcgtcgccgccctcatcgccgaacccgtccagggcgtcggcggcttcacc
tccccgcccgacggcctgtacgccgcgttccgcgaggtgctcgccgaggaggggatcctg
tggatcaccgacgaggtgcagtcgggctggggccgtaccggcgaccacttctggggctgg
caggcgcacgcgggcaacggcccgccggacatgctcaccttcgccaaggggatcggcaac
ggcacctccatcggcggcgtcgtcgcccgcgccgagatcatgaactgcctggacgccaac
tccctctccacgttcggcggcagcccggtcaccatggccgcgggcctggccaacctcggc
tacgtcctggagcacgacctccagggcaacgcccgccgcgtcggcggcctgctcatcgag
cggctgcgggccgccgcggcgggcctcgcctcggtgcgcgaggtacgcggccggggcctg
atgatcggcatcgagctggccacccccgggcacgccgcggcggtgctggagcacgcccgc
gcgggcggcctgctcgtcggccggggcaaggccggcgagacgctgcgcatcgcgccgccg
ctctccctgaccgtcgcggaggcggaggagggcgcggccgttctcgaacgggccctgcac
gccgccgacgcggagaccgccggctga

DBGET integrated database retrieval system