KEGG   Streptomyces sp. CNQ-509: AA958_29290Help
Entry
AA958_29290       CDS       T03968                                 

Definition
(GenBank) hypothetical protein
Organism
strc  Streptomyces sp. CNQ-509
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6817099..6825804
Genome map
AA seq 2901 aa AA seqDB search
MLRRDSESLVDHFRTVFEEHPEQRTFRFLVDGEGEPESLANGAFDLRARAIAAALRERVP
AGARALIMCPAGLDYVTSFFGCLYAGVLAVPVYPPDPAFLMRTLPRLTGVIEDADPGVIL
APAETVALADRFAEHAPALRDIAWLTIDDLDPAAAEDWRHPGSVRDDVAFLQYTSGSTSR
PKGVMVSHGNLLHNIAGMNSRFFADDPDQHMVSWLPPFHDMGLIFGLLTPAYAGFPVTFM
SPFSFLKRPLRWLRAISEAGGTACAAPNFAYDLAVRKVTEEERRTLDLSTWRVAANGAEP
VRQQTMERFSRTFADCGFRPSAHAPSYGLAEGTLLVSTGDPRAEPPSRTLRVSGLLSGAA
EDAGPGEAARTLPGCGTSLPDQRVVAVDPETCAALPDGRIGELWVAGRSVAGGYWRRTRE
TEETFGARLAGSGEGPFLRTGDLGFTDGDEIYVTGRIKDVIIVAGRNHYPHDIERTVEAV
DDGLRSGCGVAGTRDLDGEERLIVVQEYRGSRSPEDRARIIAGIRAEIAREHGLEAFLVA
LARPGTVPKTSSGKLQRQACLDAVLGGTLKPLAQWRADEADRDGRAGAPGAPEGPAGAHG
PGRTAPGAAEIEQWLREMLAATTGGRAEAVDPGLPFAGYGLRSVDMVTMVGDLEQRLGVP
LAPTVVWEHPTPAKLAGHLAGDLPAALPAAQAATTGRSDGSTGPGARPAATAPDPVAIVG
IGCRFPGGVDGPDDFWRLLTEGRDAVTEVPADRWDLEQFTSDDPAAPGRTTSRWGGFLDG
VDRFDAGFFGISRQEATRMDPQQRLLAEVAFEALENAGMPSDRLAGSPTGVFVGISTFDY
ATGQLRDLDAIDPYTGTGSALSISANRLSYLLDLRGPSLAVDTACSSSLVAVLQACASLE
RGDCELALAGGVNLVLSPAFAINFSKAGAMSADGRCKPFDSRADGYVRSEGAGVVVLKPL
SRALADKDPVYAVIRGGAVNQDGASNGLMAPNPQAQEGVLRAAFSNAGVRGADIGYVEAH
GTGTALGDPIEAKALGAVLGEGRDPARPCLIGSVKSNLGHMEAAAGIGGLIKAALAVRHR
TVPATLHYREPNPHIPFDDLALRVAHTLQPWPAGEDGVARAGVSSFGFGGTNAHLVLEQP
PATDPAPRQDPADDTVLLTVSARDERALRALAADYADKLAAPGLDLEVFATAAAVRRTHH
EHRLACTGSSAEELRTALSAFGRGTDAPGLSSGVRRVGWHPKPVFVFSGQGPRWWPLAAD
LLDGEPVFRAVVERCDALLRRHTDWSLLDQLTADPAGSCLQDTAVGQPALIAVQIALAAL
WRSWGVEPAAVVGHSVGEIAAAHLSGAIALEDALVIALHRGTALQSATGRGRMAVVGVGL
ERAGEILAEQRPGQVWIAAGNSPGSTVYSGETTALEALAEALRKEGLYCRVLESVEFASH
CPLMEPVAQELWGLLADLRPRTGTLPMISTVTGQPVDGDRLDAEYWASNLTRPVLFDTAI
GALAESGHDVFVEMSPHPMLTDAVTERLSSYGHTAAVSSLRSDRPGRATVRAELGRLYTA
GFPIDWTRVYGPAAPMAGLPTYPWQRTRFWYAEHTRYRPEHRGHPVLRTAVRSALPPYAA
HWSAPVALDGFGYLTDHRVGGSPALPGALVLDAWLAAAREHLGGPAALTDVHFTRLTVIP
EHAEDATLQLVLVPETADTGSLRLFTRTTGDDAWTEAAHGAFRSGAPDPGGEPLAAVRER
CATPVDTDAHYAALHRAGLAYGPAFQGVEELWCGPGEAVARLRDRPALTADRGEHPVHPA
VLDSALQTLMAALAPPAGRADAGTSIYLPVRVGGFALYAERAEPCWAYAAATAPEPGAEE
ITDATVMLYDASGAPVGEVTGIALKRLAGDTSADPLAEALYDIDWRQTPGKAEAEAGAEP
GTWLVFADAGGTCDALVTGLRARGGTCVTVTPGPGYAKPAPDQYVLDPERREDAAALLAD
LDADGIRPGGIVHAWALDAALAEDDTPARLLAVQDAATVPALHLVQEIARTGQEPAPRLV
LLTRGAQRAAAGDELSVGQAPLWGLARVIGAEHAELRPTVVDLDPARPDGEADLLLAEVL
RPGDDGQVALRHGERLTPALQRWTPSETAADAKPAWVFDAARDGNHRLLAAHPGRLASVA
ATWWHRTPPGAGQVEIEVTAAGLNFSDVLKALETYPGAKGVVPLGAECAGRVVAVGEGVT
RHRVGDRVIAVGAHSMAAFTTVVEELVAPAPLSLGEDEAAAVPIAFLTAVHALERLARLR
RGETVLIHSATGGVGLAALQVARRRGARVYATAGTEEKRELLRGLGVEHAMDSRTLAFAD
EITERTGGRGVDVVLNSATGEALVRSLRLLAPGGRFVEIGKRDVYANSHIGLELFKDNRA
LFAVDLERTIREQPEEIAGLFADIVRGFDGGEFTALPVTTHRFSDAPAAFSAMAQARHTG
KLVLRPDPHERITTAPGAAPVRPDGTYLITGGLGALGLETARYLAGAGARHLVLAGRNAP
SAAAERAVAELRDRAEVAVVSADVSQRGSLDEVLARIDATMPPLAGVVHAAGVLDDGLLT
GLDRERFRSVAAPKATAAWHLHHATSDRELDFFVLYSSAAAVLGSASQGNYAAASALLDT
LAHHRRARGLPALSIDWGPWSDIGLAARPDRGGVLAARGIESISPGDGIATLDRLLRTDA
AQVCVLPLDRDKLRDHPGGGLLGTLLGDAPGESPASRPATSEVRRRLLSVEPGRRRRAVL
TEHCRAVAARVVGAEPGRIDTSAPMNSMGFDSLLSLELRNSLVSSLRVELPSTIAWRFPT
IDALVPYLAERMDVELEPGLTVPERPAGKAASGPPAPLAGDQRSAGPLPTSAPPDLDGMS
TTDLEALLLAKTKQIDEGGRR
NT seq 8706 nt NT seq  +upstreamnt  +downstreamnt
atgctgagacgcgattccgagtcacttgtcgaccatttccgcacggtcttcgaggagcac
ccggagcaacggaccttccggttcctcgtggacggtgagggcgagccggagtccctcgcc
aacggcgcgttcgacctacgggcccgcgcgatcgccgcggcgctccgggagcgcgttccc
gccggtgcgcgggcgttgatcatgtgcccggcggggctggactacgtgacctccttcttc
ggctgcctgtacgccggcgtcctcgccgtgcccgtctacccgcccgatccggccttcctg
atgcgtaccctgccgaggctgaccggggtgatcgaggacgccgatcccggcgtgatcctc
gccccggccgagaccgtcgccctggccgaccgcttcgccgaacacgcccccgcgctgcgg
gacatcgcctggctgaccatcgacgatctcgacccggccgccgccgaggactggcgccac
cccggatcggtccgcgacgacgtcgccttcctgcagtacacctcgggttcgaccagccgt
cccaagggcgtcatggtcagccacggcaacctgctgcacaacatcgcggggatgaacagc
cggttcttcgccgacgacccggaccagcacatggtgagctggctgccgccgttccacgac
atggggctgattttcggcctgctcacccccgcctacgccggcttcccggtgacgttcatg
tcgccgttctccttcctcaagcgcccgctgcgctggctgcgggcgatctccgaagccggc
ggcaccgcgtgtgcggcgcccaacttcgcctacgacctcgccgtccggaaggtgaccgag
gaggaacggcgcacccttgacctgagcacctggcgcgtcgccgcgaacggcgccgagccg
gtccggcagcagacgatggagcgcttctcccgcacgttcgccgactgcggcttccggccg
tcggcgcatgccccttcctacggcctggccgagggcaccctgctggtctccaccggcgac
ccccgggccgaaccgcccagcagaacgctccgggtgagcggactgctgtccggcgccgcc
gaggacgccggacccggcgaggccgcccggacactgccgggctgcggcacctcgctgccc
gaccagcgggtcgtcgcggtggacccggagacctgtgccgcactgcccgacggccggatc
ggcgagctgtgggtcgccgggcggagcgtcgccggcggctactggcggcgtacgcgggag
accgaagagaccttcggcgcccggctcgccggcagcggcgagggcccgttcctgcgcacc
ggcgacctgggcttcaccgacggcgacgaaatctatgtcaccggccgcatcaaggacgtc
atcatcgtggcgggccgcaaccactacccgcacgacatcgagcgcaccgtcgaggccgtc
gacgacggcctgcggtcgggctgcggtgtggcgggcacccgtgacctcgacggcgaggag
cggctgatcgtcgtccaggagtaccgggggagccgttcgccggaggaccgcgcccggatc
atcgccggcatccgggccgagatcgcacgcgagcacggcctggaggcgttccttgtcgcg
ctggcacgccccggcaccgtaccgaagacctccagcgggaagctccagcgccaggcgtgc
ctggacgcggtactcggcgggaccctgaagccgctggcccagtggcgggcggacgaagcg
gaccgggacggccgggcgggcgctcccggggcgccggaaggtccggccggtgcgcacggc
cccggccggaccgccccgggcgcggccgagatcgagcagtggctgcgggagatgctcgcc
gccacgaccggcggccgggccgaagccgtcgaccccgggcttccgttcgccggatacgga
ctgcggtcggtcgacatggtcaccatggtcggcgacctggagcaacggctcggagtgccg
ctcgcaccgaccgtggtctgggagcatcccacccccgccaagctcgccgggcacctggcc
ggcgatctcccggcggcgctccccgcggcacaggccgcgacgaccgggcgctccgacggc
agcaccgggcccggcgcccgcccggcggccaccgcgcccgaccccgttgcgatcgtcggc
atcggatgccgcttccccggcggcgtcgacggtcccgatgacttctggcggctgctgacc
gaggggcgggacgcggtcaccgaggtcccggcggaccgttgggacctcgagcagttcacc
tccgacgaccccgccgcccccggccgtaccaccagccgctggggagggttcctcgacggc
gtcgaccggttcgacgccggcttcttcggcatctcgcggcaggaagccacccgcatggac
ccgcagcagcgcctcctcgccgaagtggcgttcgaggcactggagaacgccgggatgccc
tccgaccggctggccggatcgcccaccggcgtgttcgtcggcatctccaccttcgactac
gccaccggccagttgcgtgacctcgacgccatcgatccctacaccggcaccggcagcgcc
ctgagcatctccgcgaaccgcctgtcgtatcttctggacctgcgcggtcccagcctcgcg
gtggacaccgcgtgctcctcctcgctggtcgcggtcctccaggcctgcgcgagcctggag
cgcggtgactgcgaactggccctcgccggcggggtcaacctcgtactctccccggccttc
gccatcaacttcagcaaggccggcgcgatgtccgcggacggccggtgcaagccgttcgac
tcccgcgccgacggatacgtgcgctccgagggcgccggtgtcgtcgtactcaaaccgctg
agccgcgcgctggccgacaaagaccccgtatacgccgtgatccgcggcggtgccgtcaac
caggacggcgccagcaacggcctcatggcgcccaacccgcaggcccaggaaggggtgctg
cgtgccgccttcagcaacgcaggcgtgcggggcgcggacatcgggtacgtcgaggcccac
ggcaccggcacggcgctcggcgacccgatcgaggccaaggcgctcggtgccgtcctcggg
gagggccgtgatcccgcccgcccgtgcctgatcggctcggtgaagtccaacctggggcac
atggaggccgccgcgggcatcggcgggctgatcaaggcggcactggcggtccgccaccgc
accgtcccggcgaccctgcactaccgcgaaccgaatccgcacatccccttcgacgatctc
gccctgcgggtcgcccacaccctccagccctggccggccggcgaggacggcgtcgcacgg
gccggagtgagttcgttcggcttcggtggcaccaacgcccacctggtgctggagcaaccc
ccggccaccgaccccgcgccccggcaggacccggcggacgacaccgtcctgctgaccgtc
tcggcccgcgacgaacgcgccctgcgcgccctcgccgcggactacgccgacaagctcgcc
gcgcccggactcgacctggaggtcttcgccaccgccgcggcggtccgccgcacccaccac
gaacaccggctggcctgcaccggctcgtcggcagaggaactgcgcaccgcgctctccgcg
ttcggccgcggcacggacgcccccggcctgtccagcggcgtccggcgcgtgggctggcac
cccaagccggtgttcgtcttctccggccagggcccccggtggtggccgctggcagcagac
ctgctcgacggggagccggtgttccgcgcggtcgtcgaacgctgcgacgccctgctgcgc
cggcacaccgactggtcactgctggaccagctcaccgccgaccccgccggatcctgcctg
caggacaccgccgtcggccagcccgccctcatcgcggtgcagatcgcgctcgccgccctc
tggcgctcctggggagtcgaacctgccgccgtcgtcggccacagcgtcggtgagatcgca
gcggcacacctgtcgggagcgatcgcgctggaggacgccctcgtcatcgcactgcaccgc
ggcaccgccctgcagagcgcgaccggcaggggcaggatggcggtcgtcggcgtcggtctg
gaacgggccggggagatcctcgccgaacaacgtcccggacaggtgtggatcgcagcgggc
aacagccccggatccaccgtctactcgggggagaccaccgccctggaggcgctggccgag
gcccttcggaaagagggcctgtactgccgcgtcctggagtcggtcgaattcgcctcccac
tgccccctgatggagcccgtcgcacaggagctgtggggactgctggcggacctgcgtccg
cgcaccggcaccctccccatgatctccaccgtcaccgggcagcccgtcgacggcgaccgg
ctggacgccgagtactgggcgtccaacctcacccggccggtgctgttcgacaccgcgatc
ggcgcgctggccgagtccggtcacgacgtcttcgtcgagatgtctccgcacccgatgctc
accgacgccgtcaccgagcgcctgtcgtcgtacggtcacacggccgccgtctcgtccctg
cgcagcgaccggccgggccgcgccaccgtccgcgcggaactcggccggctctacaccgcc
ggtttccccatcgactggacccgggtgtacggcccggccgcacccatggccggccttccc
acctacccgtggcagcgcacccgcttctggtacgccgagcacacccgttaccggcccgag
caccgcgggcaccccgtcctccgcaccgccgtgcggtccgccctgcccccgtacgccgcc
cactggtccgccccggtcgcgctggacggcttcggctatctgaccgaccaccgggtcggc
ggcagccccgccctgccgggcgcgctcgtcctggacgcctggctcgcggcggcgcgcgag
cacctcggcggcccggccgctctcacggacgtccacttcacccggctgaccgtcataccc
gagcacgccgaggacgccacgctgcaactcgtcctcgtccccgagaccgccgataccggc
tcgctgcggctgttcacccggaccacgggcgacgacgcatggaccgaggccgcccacggc
gccttccgcagcggcgcgcccgaccccggcggcgaaccgctggccgccgtacgcgaacgc
tgcgccaccccggtggacaccgatgcccactacgccgcgctgcaccgggcagggctggcg
tacgggccggccttccagggcgtcgaagaactgtggtgcggccccggcgaggccgtggcc
cggctgcgcgaccggcccgccctgaccgcggaccgcggcgagcacccggtgcacccggcc
gtgctcgacagcgcgctgcagaccctcatggccgccctggcgccgcccgccggccgggcc
gacgccggcacgagcatctatctgccggtgcgcgtcggcggattcgccctctacgccgag
cgggccgaaccctgctgggcgtacgccgcggccaccgcaccggaacccggtgccgaggag
atcaccgacgccaccgtcatgctctacgacgcctccggcgcaccggtcggcgaggtcact
ggcatcgccctcaagcgcctggccggggacacctccgccgacccgctcgcggaggccctg
tacgacatcgactggcggcagacgccggggaaggccgaggccgaagccggtgcggagccc
ggcacctggctggtgttcgccgacgccggcggtacctgcgacgcgctcgtcaccggactg
cgggcccgcggcggcacctgtgtcaccgtcacccccggccccggctacgccaaaccggcc
ccggaccagtacgtgctggaccccgagcggcgcgaggatgccgccgcgctcctggccgac
ctggacgccgacggcatccgccccggcggcatcgtgcacgcctgggccctcgacgccgcg
ctcgccgaggacgacacccccgcacggctgctcgccgtccaggacgcagccaccgtgccc
gccctgcacctggtccaggagatcgcccggaccggacaggagcccgcgcctcgactggtg
ctgctcacccgcggcgcccagcgggccgccgcgggcgacgaactgtcggtcggccaggcg
ccgctgtggggactggcccgcgtgatcggcgccgagcacgccgaactgcgccccaccgtc
gtcgatctggaccccgcccgccccgacggcgaagcggatctgctcctggccgaggtgctg
cgccccggcgacgacggccaggtcgcccttcgccacggcgagcgcctgacgcccgcactc
cagcggtggacgccctccgaaacggccgcggacgccaagcccgcttgggtcttcgacgcg
gcgcgcgacggcaatcaccggctgctcgcggcccaccccggccgcctcgccagcgtcgcg
gccacctggtggcaccgcacgccgccgggagccggccaggtggagatcgaggtcaccgcc
gccggcctgaacttcagcgacgtcctgaaggctctggagacctaccccggcgcgaagggc
gtcgtccccctcggcgccgagtgcgccggccgcgtcgtcgccgtcggcgagggcgtgacc
cgtcaccgcgtcggcgaccgggtgatcgcggtcggcgcgcacagcatggcggcgttcacc
acggtcgtcgaggaactggtcgcccccgcgccgctctccctcggcgaggacgaggccgcc
gccgtacccatcgccttcctcaccgccgtccacgccctggagcgcctggcccggctgcgc
cggggcgagaccgtgctcatccactccgcgaccggcggggtcggactggccgcgctgcag
gtcgcccggcgccgcggcgcccgcgtctacgccacggccggcacggaggagaagcgcgaa
ctgctgcgcggcctcggcgtggagcacgccatggactcgcgcacgctcgccttcgccgac
gagatcaccgaacgcaccggcggccgcggcgtcgacgtcgtgctcaactccgccaccggc
gaggccctggtgcgcagcctgcggctgctggcaccgggcggccggttcgtcgagatcggc
aagcgggacgtctacgccaacagccatatcgggctggagctcttcaaggacaaccgcgcc
ctcttcgccgtggacctggaacgcaccatccgcgagcagcccgaggagatcgccgggctc
ttcgccgacatcgtccggggtttcgacggcggcgagttcaccgctctgcccgtcaccacc
caccgcttctccgacgcgccggccgccttcagcgccatggcgcaggcgcggcacaccggc
aagctggtgctgcggcccgatccccacgagcggatcaccaccgccccgggcgcggctccc
gtacggccggacggcacctacctgatcaccggcgggctcggcgcgctcggcctggagacc
gctcgctacctggccggggcgggcgcccgccacctcgtgctggcgggtcgcaacgccccc
tcggccgccgccgaacgggccgtcgccgagctgcgggaccgcgcggaggtcgccgtcgtc
agtgccgacgtgtcccagcgcggcagcctcgacgaagtcctcgcccgcatcgacgccacc
atgccgcccctggccggcgtcgtgcacgccgccggagtcctcgacgacggactgctgacc
ggcctggaccgggagcggttccgctcggtcgccgcacccaaggccaccgccgcctggcac
ctgcaccacgccacctcggaccgcgaactggacttcttcgtgctgtactcctcggcagcc
gccgtgctcggctccgccagccagggcaactacgccgccgccagcgccctcctggacacc
ctcgcccaccaccggcgtgcccgcggactgcccgcgctcagcatcgactggggtccctgg
tcggacatcggcctcgccgcccgccccgaccgcggcggcgtcctcgccgcccgcggcatc
gagagcatcagccccggcgacggcatagcgaccctcgaccggctgctgcgcaccgacgcc
gcccaggtctgcgtcctgcccctggaccgggacaagctgcgcgaccaccccggaggaggt
ctcctcggcaccctgctcggggacgcgcccggagagtccccggccagccggccggccacg
agcgaggttcgccgccgactgctctccgtcgagccgggtcgccgccgccgggccgttctg
accgagcactgccgggcggtcgcggcccgtgtggtgggcgccgagcccggcaggatcgac
accagcgcccccatgaacagcatggggttcgactcgctgctctccctggaactgcgcaac
tcgctggtgtcctcgctccgggtggagctgccctcgaccatcgcctggcgctttccgacc
atcgacgccctggtgccgtatctggcggagcgcatggacgtcgagctggaacccggcctg
acggtccccgaacgccctgccgggaaggccgcgtccggtccacccgctcccctcgccggg
gaccagcggagcgccggcccgctcccgacgagcgccccgcccgacctcgacgggatgtcc
accaccgacctcgaggcgctcctgctggccaagacgaagcagatagacgaagggggccgg
cgatga

DBGET integrated database retrieval system