KEGG   Streptomyces sp. CCM_MD2014: NI25_10895Help
Entry
NI25_10895        CDS       T04862                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
strd  Streptomyces sp. CCM_MD2014
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:strd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NI25_10895
   00650 Butanoate metabolism
    NI25_10895
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NI25_10895
   00280 Valine, leucine and isoleucine degradation
    NI25_10895
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NI25_10895
Enzymes [BR:strd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     NI25_10895
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     NI25_10895
Amino acid related enzymes [BR:strd01007]
 Aminotransferase (transaminase)
  Class III
   NI25_10895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2566007..2567341
Genome map
AA seq 444 aa AA seqDB search
MTALPQERRVVTAIPGPKSQELQARRTAVVAQGVGSTLPVFVARAGGGVIEDVDGNRLID
FGSGIAVTSVGASAEAVVRKASAQLADFTHTCFMVTPYEGYVAVAEALAELTPGDHAKKS
ALFNSGAEAVENAVKIARAYTKRPAVVVFDHGYHGRTNLTMALTAKNMPYKHGFGPFAPE
VYRVPVAYGYRWPTGAENAGPEAAAQAIDQITKQVGAENVAAIIIEPVLGEGGFIEPAKG
FLPAIREFASDNGIVFVADEIQSGFCRTGQWFACEDEGIVPDLITTAKGIAGGLPLSAVT
GRAEIMDAAHSGGLGGTYGGNPVACAGALGAIETMKELDLNARAKNIEAVMKSRLAAMAE
KFDVIGDVRGRGAMIAIELVKDRDTKEPNPEATAALAKACHQEGLLVLTCGTYGNVLRFL
PPLVIGEDLLNEGLDIIEQAFAGI
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacttccgcaggagcgccgcgtcgtcaccgccattcccggcccgaagtcgcag
gagctgcaggcccgccgtacggccgtggtcgcgcagggtgtgggctccacgctgcccgtc
ttcgtggcgcgcgccggtggcggtgtcatcgaggacgtcgacggcaaccgtctgatcgac
ttcggttccggcatcgcggtgacctccgtcggcgcctccgccgaggccgtcgtgcgcaag
gcgtccgcacagctcgccgacttcacccacacctgtttcatggtcacgccgtacgagggc
tacgtcgccgtcgccgaggcgctggccgagctgacgccgggcgaccacgccaagaagtcg
gcgctgttcaacagcggcgccgaggccgtcgagaacgccgtcaagatcgcgcgtgcgtac
accaagcggccggccgtcgtcgtcttcgaccacgggtaccacggccggaccaacctgacg
atggccctgaccgcgaagaacatgccgtacaagcacggcttcggccccttcgcccccgag
gtctaccgcgtgccggtcgcctacggctaccgctggccgaccggcgcggagaacgccggc
ccggaggccgccgcgcaggcgatcgaccagatcaccaagcaggtcggcgcggagaacgtg
gccgcgatcatcatcgagccggtgctcggcgagggcggcttcatcgagccggccaagggc
ttcctgccggcgatccgcgagttcgcctcggacaacggcatcgtcttcgtcgcggacgag
atccagtccggcttctgccgtaccggccagtggttcgcctgcgaggacgagggcatcgtc
ccggacctgatcacgacggcgaagggcatcgcgggcggcctgccgctgtccgccgtcacc
ggccgcgccgagatcatggacgccgcgcactccggcggcctcggcggcacctacggcggc
aacccggtggcctgcgcgggcgcgctcggtgccatcgagacgatgaaggagctggacctc
aacgccagggcgaagaacatcgaggcggtcatgaagtcccgcctggccgccatggcggag
aagttcgacgtcatcggcgacgtccggggccgcggcgcgatgatcgcgatcgagctggtc
aaggaccgcgacaccaaggagccgaacccggaggcgaccgccgcgctcgccaaggcctgc
caccaggaggggctgctggtcctgacctgcggcacctacggcaacgtgctgcggttcctg
ccgccgctggtgatcggcgaggacctgctgaacgagggcctcgacatcatcgagcaggcc
ttcgccggtatctga

DBGET integrated database retrieval system