KEGG   Streptomyces sp. 769: GZL_07229Help
Entry
GZL_07229         CDS       T03587                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
stre  Streptomyces sp. 769
Pathway
stre00020  Citrate cycle (TCA cycle)
stre00480  Glutathione metabolism
stre01100  Metabolic pathways
stre01110  Biosynthesis of secondary metabolites
stre01120  Microbial metabolism in diverse environments
stre01130  Biosynthesis of antibiotics
stre01200  Carbon metabolism
stre01210  2-Oxocarboxylic acid metabolism
stre01230  Biosynthesis of amino acids
Module
stre_M00009  Citrate cycle (TCA cycle, Krebs cycle)
stre_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:stre00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GZL_07229
  Metabolism of other amino acids
   00480 Glutathione metabolism
    GZL_07229
Enzymes [BR:stre01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     GZL_07229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AJC59781
UniProt: A0A0A8F049
LinkDB All DBs
Position
7788308..7790551
Genome map
AA seq 747 aa AA seqDB search
MDGAEYPVTDSTIIYTHTDEAPALATYSFLPVVEAYAAKAGVTLETRDISLSGRIIASFP
ERLKEDQRIADALAELGQLAKTPGANIIKLPNISASIPQLKAAIAELQEQGYALPDYPDD
PKTDEERETRARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKAHPHRMGAWTADSKTNV
ATMGENDFRATEKSAVIAEDGSLRIELVAEDGTTTVLRESVPVLAGEVVDASVMRVAQLR
EFLAAQVVRAKAEGVLFSVHLKATMMKVSDPIVFGHVVRAFFPKTFAQYGEALAAAGLTP
NDGLGGIFKGLEALSNGAEIKASFDAELAEGPELAMVDSDRGITNLHVPSDVIVDASMPA
MIRTSGHMWGPDGQEADTLAVLPDSSYAGIYQAVIDDCRAHGAFDPATMGSVPNVGLMAQ
KAEEYGSHDKTFEVAAAGTVRLVDAHGNVVIEQAVAAGDIFRACQTKDAPIKDWVKLAVS
RARATGDPAVFWLDETRAHDAQLIAKVNAYLAEHDTEGLEIKILAPVEATAFSLERIRRG
ADTISVTGNVLRDYLTDLFPILELGTSAKMLSVVPLMNGGGLFETGAGGSAPKHVQQLVK
ENYLRWDSLGEFLALAVSFEHLATTTDNTRAKVLADTLDRATGSFLNENKSPSRKLGGID
NRGSHFYLALYWAQELAKQTDDAQLAEAFGPLAKTLTEQEQTIVDELIAVQGSPVDIGGY
FRPDPAKASAVMRPSKTLNQALAALRG
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
gtggatggagcggagtacccggtgactgactcgaccatcatttacacccacactgacgag
gccccggccctggcgacgtactcgttcctgccggtggtggaggcgtacgccgcgaaggcc
ggggtgacgctggagacccgcgacatctccctgtcgggccggatcatcgccagcttcccc
gagcgcctgaaggaggaccagcggatcgccgacgccctcgcggagctcggccagctggcc
aagacccccggcgcgaacatcatcaagctgccgaacatctcggcctccatcccgcagctc
aaggcggccatcgccgagctccaggagcagggctacgcgctgccggactacccggacgac
ccgaagaccgacgaggagcgcgagacccgcgcccgctacgacaaggtcaagggcagcgcc
gtcaaccccgtgctgcgcgagggcaattcggaccgccgggcgcccgcgtcggtgaagaac
tacgccaaggcgcacccgcaccgcatgggtgcctggaccgccgactccaagaccaacgtc
gcgaccatgggcgagaacgacttccgcgccaccgagaagtccgccgtgatcgccgaggac
ggctccctgcgcatcgagctggtggccgaggacggcaccaccaccgtgctgcgcgagtcg
gtgccggtgctcgcgggcgaggtggtggacgcctccgtcatgcgcgtcgcccagctccgt
gagttcctcgccgcccaggtcgtgcgcgccaaggcggagggtgtgctgttctccgtgcac
ctgaaggccacgatgatgaaggtctccgacccgatcgtcttcggccacgtcgtacgggcc
ttcttccccaagaccttcgcccagtacggcgaggcactggccgcggccggcctcaccccg
aacgacggcctcggcggcatcttcaagggcctggaggcgctgtccaacggcgccgagatc
aaggcgtccttcgacgccgagctggccgagggcccggagctggccatggtcgactccgac
cgcggcatcaccaacctgcacgtccccagcgacgtcatcgtggacgcgtccatgcccgcg
atgatccgcacctccggccacatgtggggcccggacggccaggaggcggacaccctcgcg
gtgctccccgacagcagctacgccggcatctaccaggccgtcatcgacgactgccgggcg
cacggcgcgttcgacccggccaccatgggctcggtgccgaacgtcggcctgatggcgcag
aaggccgaggagtacggctcccacgacaagaccttcgaggtcgcggccgcgggcaccgtc
cgcctggtcgacgcgcacggcaacgtcgtcatcgagcaggccgtcgccgccggtgacatc
ttccgcgcctgccagaccaaggacgcgccgatcaaggactgggtcaagctggccgtcagc
cgcgcccgcgccaccggcgacccggcggtgttctggctcgacgagacccgcgcgcacgac
gcccagctgatcgcgaaggtcaacgcctacctcgcggagcacgacaccgagggcctggag
atcaagatcctggccccggtcgaggcgaccgcgttctccctggagcggatccgccgcggc
gcggacaccatctcggtcaccggcaacgtcctgcgcgactacctgaccgacctgttcccg
atcctggagctgggcaccagcgccaagatgctctcggtcgtcccgctgatgaacggcggc
ggcctgttcgagaccggtgccggtggttccgcgcccaagcacgtccagcagctggtcaag
gagaactacctgcgctgggacagcctgggcgagttcctcgcgctcgcggtcagcttcgag
cacctcgcgacgaccacggacaacacccgtgccaaggtcctcgccgacaccctcgaccgc
gcgaccggttcgttcctcaacgagaacaagtcgccgagccgcaagctgggcggcatcgac
aaccgcggcagccacttctacctggcgctctactgggcccaggagctggccaagcagacc
gacgacgcgcagctcgccgaggcgttcgggccgctggccaagacgctgaccgagcaggag
cagaccatcgtcgacgagctgatcgcggtgcagggctccccggtcgacatcggcggctac
ttccgccccgacccggccaaggcgtccgcggtgatgcgtccctcgaagacgctgaaccag
gcgctggcggccctgcggggctga

DBGET integrated database retrieval system