KEGG   Streptomyces sp. 769: GZL_08500Help
Entry
GZL_08500         CDS       T03587                                 

Definition
(GenBank) hypothetical protein
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
stre  Streptomyces sp. 769
Brite
Enzymes [BR:stre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     GZL_08500
Peptidases [BR:stre01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   GZL_08500
Exosome [BR:stre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GZL_08500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(9088762..9089553)
Genome map
AA seq 263 aa AA seqDB search
MARSWLRRGAAAVAVCGAVLTSVPPATAAGGPVAPDTRIVGGRNADVRDVPWQVSLRSRG
GHICGGSIIRADAVVTAAHCTVGAPPDSLTVQAGSSVRGSGGQIVPVARVLRHPKFNAAT
IDYDVAVLELASPLDFGAGVRAVPLLPEGREPITGTPATVTGWGATRDGGTLPERLRRVD
VPKLSDTYCKGAYGTSSITPRMTCYGYEGGRKDACQGDSGGPLVVDGYLAGIASWGTGCA
SPGHPGVYTKVSDPSIHAYIARS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcacggtcatggttgcggcgaggggcggcggcggtcgcggtgtgcggtgcggtgctg
acgtcggttccaccggcgacggcggcgggcggtccggtggcgccggacacccgcatcgtg
ggcgggcggaacgcggacgtgcgggacgtgccgtggcaggtgtcgttgcgcagccgcggc
ggacacatctgcggtggttcgatcatccgcgccgatgcggtggtgaccgcggcgcactgc
accgtgggggcgccgccggactccttgaccgtccaggcgggcagcagcgtgcgcgggtcg
ggcgggcagatcgtgccggtggcgcgggtgttgcggcacccgaagttcaacgcggccacg
atcgactacgacgtggcggtgctggaactggcgtccccgctggatttcggggccggggtg
cgcgcggttccgctgctgccggagggcagggagccgatcaccggcacaccggcgacggtc
accggctggggtgcgacgcgggacggcggcacactgccggagcggctgcggcgggtcgat
gtgcccaagctcagcgacacgtactgcaagggggcgtacgggacgtcctcgatcaccccg
cggatgacgtgctacggctacgagggcgggcgcaaggacgcgtgccagggcgacagcggg
ggcccgctggtggtggacgggtacctggcggggatcgcgtcatgggggacggggtgcgcc
tcgcccgggcatcccggcgtctacaccaaggtcagcgatccgtcgatccacgcgtacatc
gcccggtcctag

DBGET integrated database retrieval system