KEGG   Streptomyces sp. 4F: ASR50_01210Help
Entry
ASR50_01210       CDS       T04265                                 

Definition
(GenBank) polyketide synthase
Organism
strf  Streptomyces sp. 4F
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(313040..314785)
Genome map
AA seq 581 aa AA seqDB search
MSGHRTFTQHLQAQAARTPDREALILLTERDGRMEPQTITYGELDRAARTLAAALRRHVE
PGERVLIAHRSRARFVTGFLACLYAGAVAVPVAPPGGRGHHDARIAGIVKEAAAVCVLTS
TDEAAEVSQLLARTGHGQVVCLPADSPAATGAPEPAEPFAPGPDTVAYLQYTSGSTRDPR
GVIVTHRSLLANQRAIQNALGTRPGIRMGGWLPLHHDMGLVGELLHALWLGGTSVLMSPA
TFVKRPANWLEAIGTYGLTVSGAPDFAYRLCLRRINDTQLAGLDLSGWEVAVNGGEPIDP
ATMTEFAERFAPAGLRPGALTPCYGLAEATLLVSGTRTAPSAAARTVDAAALETGRLAPP
AGPGHDLAHCGPPASADLRIVDPETCRELPDGRIGEIWVRGDSVGPGYWARPAETAAAFG
CRIEGAGGGYLRTGDLGALDGGLLHVTGRLKDMIVVAGRNLYPQDLERTVQQLSGHFGAA
TAFSVPGACERIVIVQELRVRSRYDIDLAALATAVQQRVSEEYEVHAAGVLLVRPGTVRR
TTSGKVERAAMRRLFLRGELAPLHQRLEPEVELLLAAGKRR
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggacaccggacctttacgcaacaccttcaggcccaggccgcgaggaccccggac
cgggaggcgctgatcctcctcaccgagcgcgacggccgcatggagccgcagacgatcacg
tacggagaactcgaccgcgcggcacgcacgttggcggccgcgctgcgccgccatgtcgag
ccgggggagcgggtgctgatcgcgcaccgctcgcgcgcccggttcgtcaccggcttcctg
gcctgtctgtacgcgggcgcggtcgccgtgcccgtcgccccgcccggcggccgtggccat
cacgacgcccggatcgccgggatcgtcaaagaggcggccgcggtctgcgtgctcacctcc
acggacgaggccgcggaagtctcccagctgctcgcccgcaccggccacggccaggtggtc
tgcctgccggccgacagccccgccgccaccggcgcccccgagcccgcggagccgttcgca
cccggcccggacacggtcgcctacctccagtacacctccggctccacccgcgatccgcgc
ggtgtgatcgtcacgcaccgcagcctgctcgccaaccagcgggccatccagaacgccctc
ggcacacgccccggcatccggatgggcggctggctgccgctgcaccacgacatggggctc
gtcggcgaactcctgcacgccctctggctcggcggcacctccgtgctcatgtcaccggcc
acgttcgtcaaacggccggcgaactggctggaggcgatcgggacatacggcctgacggtc
agcggcgcaccggacttcgcataccgcctgtgcctgcgccgcatcaacgacacgcagctc
gcgggcctcgacctgtccggctgggaggtcgcggtcaacggcggcgaacccatagacccc
gcgaccatgacggagttcgccgaacgcttcgccccggccggtctgcgccccggcgccctg
acaccctgctacggactggccgaggcgaccctgctggtctccggcacacgcaccgccccg
tccgccgccgcccgtaccgtcgacgcggcggccctggagaccggccggctcgcgcctccc
gccggccccggccacgacctcgcgcactgcgggccgcccgcctccgccgacctgcgcatc
gtcgatccggagacctgccgcgagctgccggacggccggatcggcgagatctgggtccgc
ggcgacagcgtcggccccggctactgggcgcgccccgccgagaccgcggcggccttcggc
tgccggatcgagggcgcgggcggcggctatctgcgcaccggtgacctcggcgcgctggac
ggcgggctgctccatgtcacgggccggctcaaggacatgatcgtcgtcgccgggcgcaac
ctgtatccgcaggacctggagcgcacggtccagcagctcagcggtcacttcggcgccgcc
accgccttctcggtgcccggcgcatgcgaacgcatcgtcatcgtccaggagctgcgggtc
cgcagccgttacgacatcgacctggcggcgctcgccaccgccgtccagcagcgtgtgagc
gaggagtacgaggtgcacgcggccggcgtgctgctcgtccggcccggcaccgtacgccgc
accaccagcggcaaggtcgaacgcgcggccatgcgccggctcttcctgcgcggcgaactc
gccccgctgcaccagcgcctggaacccgaggtcgaactcctcctggcggccgggaagcgg
cgatga

DBGET integrated database retrieval system