KEGG   Streptomyces sp. 4F: ASR50_21645Help
Entry
ASR50_21645       CDS       T04265                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
strf  Streptomyces sp. 4F
Pathway
strf00473  D-Alanine metabolism
strf01100  Metabolic pathways
strf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:strf00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    ASR50_21645
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    ASR50_21645
Enzymes [BR:strf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     ASR50_21645
Peptidoglycan biosynthesis and degradation proteins [BR:strf01011]
 Precursor biosynthesis
  Racemase
   ASR50_21645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C DUF3775
Motif
Other DBs
NCBI-ProteinID: ALV51754
UniProt: A0A0U3R2D5
LinkDB All DBs
Position
4806614..4807792
Genome map
AA seq 392 aa AA seqDB search
MKETADPHGAQLRARAVIDLAAVRANVRTLRDRAPRAALMAVVKADGYGHGAAPCARAAV
EAGATWLGTATPQEALALRAPGSGVPDDVRVMCWLWTPGGPWREAVEADVDVSVSGFWAL
DEVVAAARAAGRPARVQLKADTGLGRGGCQPADWAELVAGALRAQAEGLLKVTGLWSHFA
CADEPGHPSIAAQLLTFREMVAYAEAQGVEPEVRHIANSPATLTLPESHFDLVRPGIAMY
GVSPSPEIGTPVELGLRPAMTLSASLALVKNVPGGHGVSYGHHYVTAGATTLGLVPLGYA
DGIPRHASGGGPVLVEGKWRTVAGRVAMDQFVVDLGGDEPGEGAEAVLFGPGDRGEPTAE
DWAQASGTIAYEIVTRIGSRVPRVYVNGEQSG
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagacagctgacccgcacggcgcgcagctccgcgcccgcgctgtgatcgatctg
gccgccgtgcgggccaacgtacgcaccctccgcgaccgcgccccccgcgccgccctgatg
gccgtcgtcaaggccgacgggtacgggcacggcgcggccccctgcgcccgcgcggccgtg
gaggccggtgcgacctggctgggtaccgccaccccgcaggaggcgctcgcgctgagggcg
ccggggtcgggcgtgccggacgacgtccgggtgatgtgctggctgtggacgcccggaggg
ccctggcgggaggctgtcgaggccgacgtcgacgtctcggtgagcgggttctgggcgctg
gacgaggtcgtcgcggcggcacgggcggccggccggcccgcgcgggtgcagctgaaggcg
gacaccgggctggggcggggcgggtgccagcccgcggactgggccgagctggtcgcgggc
gcgctgcgtgcgcaggccgaggggctgctgaaggtcaccgggctgtggtcgcacttcgcc
tgcgccgacgagccgggacacccgtcgatcgccgcgcagctgctcaccttccgggagatg
gtggcgtacgccgaggcgcagggcgtcgagcccgaggtgcggcacatcgccaactcgccc
gcgacgctgacgttgcccgagagccacttcgacctggtgcggcccggcatcgcgatgtac
ggcgtgtcgcccagcccagagatcggcacgccggtggagctggggctgcgccccgcgatg
acgctctccgcgtcgctggcgctggtgaagaacgtgccgggcgggcacggggtcagttac
gggcatcactacgtgaccgccggggcgacgactctggggctcgtgcctctcgggtacgcc
gacggaattccccggcacgcctcgggcggggggcccgtgctggtggaggggaagtggcgg
accgtcgccgggcgggtcgccatggaccagttcgtcgtcgatctggggggtgacgagccc
ggggagggggccgaggccgtactgttcgggcccggtgaccggggcgagcccaccgcggag
gactgggcgcaggcgtccgggaccatcgcgtacgagatcgtgacccggatcggcagccgt
gtcccgcgtgtgtatgtgaacggggaacagagcgggtaa

DBGET integrated database retrieval system