KEGG   Streptomyces sp. 4F: ASR50_24030Help
Entry
ASR50_24030       CDS       T04265                                 

Gene name
kgd
Definition
(GenBank) alpha-ketoglutarate decarboxylase
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
strf  Streptomyces sp. 4F
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:strf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ASR50_24030 (kgd)
  Amino acid metabolism
   00310 Lysine degradation
    ASR50_24030 (kgd)
   00380 Tryptophan metabolism
    ASR50_24030 (kgd)
Enzymes [BR:strf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     ASR50_24030 (kgd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(5337637..5341434)
Genome map
AA seq 1265 aa AA seqDB search
MSPQSPSNSSISTDTDQAGKNPAAAFGANEWLVDEIYQQYLQDPNSVDRAWWDFFADYKP
GAPASSAPAGDAAAGAAVTPTAPSQPAPPAKAQAPAQPAPAAKAPAQTQAPAQAKAPAQP
AKQAAPAAKPAPARKAEPAGEAKSGPEQVTLRGPSAAVAKNMDASLELPTATSVRAVPVK
LLFDNRIVINNHLKRARGGKISFTHLIGYAMVQAIKAMPSMNNSYAKVDGKPTLVKPEHI
NLGLAIDLVKPNGDRQLVVAAIKKAETLNFFEFWQAYEDIVRRARDNKLTMDDFTGVTVS
LTNPGGLGTVHSVPRLMPGQSVIMGVGSMDYPAEFQGTSQDTLNKLGISKVMTLTSTYDH
RVIQGAASGEFLRQVANLLLGENNFYDEIFEALRIPYEPVRWLKDIDASHDDDVTKAARV
FDLIHSYRVRGHVMADTDPLEYKVRKHPDLDIVEHGLTLWDLEREFAVGGFAGKSMMKLR
DILGVLRDSYCRTTGIEFMHIQDPKQRKWIQDRVERGHTKPEREEQLRILRRLNAAEAFE
TFLQTKYVGQKRFSLEGGESVIPLLDAVLDSAAESRLDEVVIGMAHRGRLNVLANIVGKS
YAQIFREFEGNLDPKSMHGSGDVKYHLGAEGTFTGLDGEQIKVSLVANPSHLEAVDPVLE
GVARAKQDIINKGGTDFTVLPVAIHGDAAFAGQGVVAETLNMSQLRGYRTGGTVHVVINN
QVGFTAAPESSRSSMYATDVARMIEAPIFHVNGDDPEAVVRVARLAFEFRQAFNKDVVID
LICYRRRGHNESDNPAFTQPLMYDLIDKKRSVRKLYTESLIGRGDITLEEAEQALQDYQG
QLEKVFTEVREATSQPATAVPSDPQAEFPVAVNTAVSSEIVKRIAESQVNIPDHVTVHPR
LLPQLQRRATMVEDGTIDWGMGETLAIGSLLLEGVPVRLAGQDSQRGTFGQRHAVIIDNK
TGEEYTPLQYLSEDQARLNVYNSLLSEYAAMGFEYGYSLARPDALVLWEAQFGDFVNGAQ
TVVDEFISSAEQKWAQTSGVVLLLPHGYEGQGPDHSSARPERFLQLCAQNNMTVAMPTSP
SNYFHLLRWQVHNPHHKPLVVFTPKSMLRLKAAAAKADEFTTGQFRPVIGDDTVDPAAVK
KVVFCAGKVYYDLAAERKKRGADDTAIIRIERLYPLPGAELQAEIKKYPNAEKYLWAQEE
PANQGAWPFIALNLIDHLDLAVGADLPHDERLRRISRPHSSSPAVGSAKRHQAEQEQLVR
EVFEA
NT seq 3798 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgccacagtcccccagtaactcgagcatctcgaccgacaccgaccaagcgggaaag
aaccccgctgcggccttcggtgccaacgaatggctcgtcgacgagatctaccagcagtac
ctccaggacccgaactcggtggaccgagcctggtgggacttcttcgccgactacaagccg
ggcgctcccgcgtcctcggctccggcgggtgacgcggccgcgggggccgcggtgaccccc
accgctccgtcccagccggccccgcccgcgaaggctcaggcgcccgcgcagcccgccccg
gccgccaaggccccggcgcagacgcaggcccccgcgcaggcgaaggccccggcccagccg
gcgaagcaggccgctcccgccgccaagccggcgccggccaggaaggccgagcccgcgggc
gaggcgaagagcggtcccgagcaggtcaccctgcgcggcccgtccgccgcggtggccaag
aacatggacgcctcgctggagctgcccacggccacgtccgtgcgcgcggtcccggtgaag
ctgctgttcgacaaccgcatcgtcatcaacaaccacctgaagcgcgcgcggggcgggaag
atctccttcacgcacctcatcggctacgccatggtgcaggccatcaaggccatgccgtcg
atgaacaactcgtacgccaaggtggacggcaagccgaccctggtgaagccggagcacatc
aacctcggtctcgccatcgacctggtcaagcccaacggcgaccgccagctcgtcgtcgcg
gcgatcaagaaggccgagacgctgaacttcttcgagttctggcaggcctacgaggacatc
gtccgtcgcgcccgcgacaacaagctgacgatggacgacttcaccggtgtcacggtctcc
ctgaccaaccccggcggcctcggcaccgtccactccgtgccgcgtctgatgcccggccag
tccgtgatcatgggcgtcggctccatggactacccggcggagttccagggcacctcccag
gacaccctgaacaagctcggcatctcgaaggtcatgacgctcacgtcgacctacgaccac
cgggtgatccagggcgccgcctccggcgagttcctgcgccaggtcgcgaacctcctcctc
ggcgagaacaacttctacgacgagatcttcgaggccctgcgcatcccctacgagccggtc
cgctggctcaaggacatcgacgccagccacgacgacgacgtcaccaaggccgcccgggtc
ttcgacctgatccactcctaccgggtccgcggccacgtcatggccgacaccgacccgctc
gagtacaaggtccgcaagcaccccgacctggacatcgtcgagcacggcctcaccctgtgg
gacctggagcgcgagttcgccgtcggcggtttcgccggcaagtcgatgatgaagctgcgc
gacatcctcggcgtgctccgcgactcgtactgccgcaccaccggcatcgagttcatgcac
atccaggaccccaagcagcgcaagtggatccaggaccgcgtggagcgcggccacaccaag
ccggagcgcgaggagcagctgcgcattctgcgccggctgaacgcggcggaggccttcgag
accttcctgcagaccaagtacgtcggccagaagcgcttctcgctggagggcggcgagtcc
gtcatcccgctgctcgacgcggtgctggactcggccgccgagtcccgcctggacgaggtc
gtcatcggcatggcccaccgcggccgcctcaacgtcctcgccaacatcgtcggcaagtcg
tacgcgcagatcttccgcgagttcgagggcaacctcgacccgaagtcgatgcacggctcc
ggcgacgtgaagtaccacctgggcgccgagggcaccttcaccggcctggacggcgagcag
atcaaggtctcgctggtcgccaacccctcgcacctggaggcggtcgacccggtcctggag
ggcgtcgcccgcgccaagcaggacatcatcaacaagggcggcacggacttcaccgtcctg
ccggtggccatccacggcgacgcggccttcgcgggccagggcgtggtggccgagaccctg
aacatgtcgcagctgcgcggctaccgcaccggcggcaccgtgcacgtcgtcatcaacaac
caggtcggcttcaccgcggcccccgagtcctcgcgctcctccatgtacgcgacggacgtg
gcccgcatgatcgaggccccgatcttccacgtgaacggcgacgacccggaggcggtggtg
cgcgtcgcgcgcctggccttcgagttccgccaggcgttcaacaaggacgtggtgatcgac
ctcatctgctaccgccgccgcggtcacaacgagtccgacaacccggccttcacccagccg
ctgatgtacgacctgatcgacaagaagcgctcggtgcgcaagctctacaccgagtccctc
atcggtcgcggcgacatcaccctggaagaggccgagcaggcgctgcaggactaccagggc
cagctggagaaggtcttcaccgaggtccgcgaggccacctcgcagccggccacggccgtc
ccgtcggacccgcaggccgagttcccggtcgccgtgaacaccgcggtgagctcggagatc
gtgaagcggatcgccgagtcccaggtcaacatcccggaccacgtcaccgtccacccgcgt
ctgctgccgcagctgcagcgccgggccacgatggtcgaggacggcacgatcgactggggc
atgggcgagaccctcgccatcggctccctcctgctggagggcgtcccggtccggctggcc
ggccaggactcgcagcgcggcaccttcggccagcgccacgcggtgatcatcgacaacaag
acgggcgaggagtacacgccgctccagtacctctccgaggaccaggcgcgcctcaacgtc
tacaactcgctgctgtccgagtacgcggccatgggcttcgagtacggctactcgctggcc
cgcccggacgcgctcgtgctctgggaggcgcagttcggcgacttcgtcaacggcgcgcag
acggtcgtggacgagttcatctcgtcggccgagcagaagtgggcccagacctccggtgtg
gtcctgctcctcccgcacggctacgagggccagggcccggaccactcctcggcccgcccg
gagcgcttcctgcagctctgcgcccagaacaacatgacggtcgccatgccgacctcgccg
tcgaactacttccacctcctgcggtggcaggtgcacaacccgcaccacaagccgctggtg
gtcttcacgccgaagtcgatgctgcgtctcaaggccgccgcggcgaaggcggacgagttc
acgacgggccagttccgcccggtcatcggcgacgacacggtcgacccggccgccgtgaag
aaggtcgtcttctgcgccggcaaggtctactacgacctggccgccgagaggaagaagcgc
ggcgcggacgacacggcgatcatccgcatcgagcgcctgtacccgctgccgggtgccgag
ctccaggcggagatcaagaagtacccgaacgccgagaagtacctgtgggcgcaggaggag
ccggcgaaccagggtgcctggccgttcatcgcgctcaacctgatcgaccacctggacctg
gcggtcggcgccgacctgccgcacgacgagcgtctgcgccgcatctcgcggccgcacagc
tcgtccccggcggtcggctccgccaagcgccaccaggccgagcaggagcagctggtgcgc
gaggtcttcgaggcctga

DBGET integrated database retrieval system