KEGG   Streptomyces sp. 4F: ASR50_28810Help
Entry
ASR50_28810       CDS       T04265                                 

Definition
(GenBank) aminotransferase class III
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
strf  Streptomyces sp. 4F
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:strf00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ASR50_28810
   00650 Butanoate metabolism
    ASR50_28810
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ASR50_28810
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ASR50_28810
Enzymes [BR:strf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ASR50_28810
Amino acid related enzymes [BR:strf01007]
 Aminotransferase (transaminase)
  Class III
   ASR50_28810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6510294..6511580
Genome map
AA seq 428 aa AA seqDB search
MNDDLLGRHRAVLPDWLALYYDRPLEITHGEGRHVWDAQGNRYLDFFGGILTTMTAHALP
EVTKAVTEQAGRIIHSSTLYLNRPMVDLAERIAQLSGIPDARVFFTTSGTEANDTALLLA
TTYRRSNTVLAMRNSYHGRSFSSVGITGNRGWSPTSLSPLQTLYVHGGVRGRGPFAELDD
YDYVAACVDDLKDLLGHTRPPAALIAEPIQGVGGFTSPPDGLYAAFREVLHERGVLWISD
EVQTGWGRTGEHFWGWQAHARSGPPDMLTFAKGIGNGMSIGGVVARAEIMNCLDANSIST
FGGTQITMAAGLANLNYLLEHDLQGNARRVGGLLIERLRAAAAHVPAVREVRGRGLMIGI
ELTKPGTDEADPAAASAVLEAARAGGLLIGKGGGHDTSALRVAPPLSLNVAEAEEGAAIL
EDALRSIQ
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgacgacctgctcggccgccaccgcgccgtcctccccgactggctggccctctac
tacgaccggcccctggagatcacccacggcgagggacgtcacgtctgggacgcccagggc
aaccgctacctggacttcttcggcggcatcctcaccaccatgaccgcccacgccctgccc
gaggtcaccaaggcggtgacggaacaggccgggcggatcatccactcctccaccctctat
ctgaaccggccgatggtggacctcgccgaacggatcgcccagctcagcggcatccccgac
gcccgggtcttcttcaccacctccggcaccgaggccaacgacaccgcgctgctgctcgcc
accacctaccggcgcagcaacacggtcctggcgatgcgcaacagctaccacggccgctcc
ttcagctcggtcggcatcaccggcaaccgcggctggtccccgacctcgctctccccgctg
cagacgctgtacgtgcacggcggggtccgcggccgaggcccgttcgccgagctcgacgac
tacgactacgtcgccgcctgcgtcgacgacctcaaggacctcctcgggcacacccgcccg
cccgccgcgctgatcgccgagccgatccagggcgtcggcggcttcacctcaccgcccgac
ggcctctacgccgcgttccgcgaggtgctgcacgagcggggcgtgctgtggatctccgac
gaggtgcagaccggctggggccgcaccggcgagcacttctggggctggcaggcacacgcc
cgcagcggcccgcccgacatgctgaccttcgccaagggcatcggcaacggcatgtccatc
ggtggcgtcgtcgcccgcgccgagatcatgaactgcctggacgccaacagcatctccacg
ttcggcggcacccagatcaccatggcggcgggcctcgccaacctcaactacctgctggag
cacgacctccagggcaacgcccgccgcgtcggcggtctgctcatcgagcggctgcgggcc
gccgccgcccacgtccccgccgtacgggaggtacgcggacggggcctgatgatcggcatc
gagctgacgaagcccggtaccgacgaggccgaccccgccgccgcgtccgccgtcctggag
gccgcccgcgccggcggtctgctcatcggtaagggcggaggccacgacaccagcgccctg
cgcgtcgcgccgccgctctccctcaacgtcgcggaggccgaggagggcgccgcgatcctc
gaggacgccctgaggagcatccagtag

DBGET integrated database retrieval system