KEGG   Streptomyces sp. 4F: ASR50_28895Help
Entry
ASR50_28895       CDS       T04265                                 

Definition
(GenBank) neuramidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
strf  Streptomyces sp. 4F
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:strf00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    ASR50_28895
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ASR50_28895
Enzymes [BR:strf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     ASR50_28895
Bacterial toxins [BR:strf02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   ASR50_28895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6531519..6533006
Genome map
AA seq 495 aa AA seqDB search
MQRRATLAATTAGAALALLVAGTPAAHPATPAAQAAPAPGTLVSQDIATAGTGSPYYRIP
ALTRTTKGTLLAAYDARPTLGDLPGNLGVVLRRSTDGGTTWQAQQVIRKEAAPKGFGDPS
LLVDRETGRVFVFYAASVNQGFFGSATGNDESDPNVLQADYSYSDDDGLTWKHERITAEI
KNPAWAGMFAASGEGIQVRNGTYKGRLIQQYAIRNNGANYAVSAYSDDHGATWKMGTPVG
PGGDENKTVELSDGRIMLNNRSAPYRTVAYSSDGGVTYTPFQQDKELPDPANNGSVARFA
PDVPATHPRAQWLMFSNTATTNSRSNLTVRLSCDNGQNWPVRKTVESGAAAYSTLTPLGT
GTAGNDRVGLLWERANYQHITYSSFDVQWLGGVCAPVTVTPPASLPAGRTTEVTVRVVSQ
NDKDLPSGSVALTLPSGWSAPSVTVPALKPGQGANMRVPVTVPAGASGGAPVTATYLVRG
TQRSYGDGTLTVTTS
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcagagccaccctggccgccaccaccgcgggcgccgccctggccctcctggtc
gccggcacccccgccgcccacccggccacgcccgccgcgcaggccgcccccgccccgggc
acgctcgtctcgcaggacatcgccaccgccggcaccggttcgccgtactaccgcatcccc
gccctgacccgcaccaccaagggcaccctgctcgccgcctacgacgcccgccccaccctc
ggcgacctgcccggcaacctcggcgtggtactgcgccgcagcaccgacggcggcaccacc
tggcaggcccagcaggtgatccgcaaggaggccgcgcccaagggcttcggcgaccccagc
ctcctcgtcgaccgggagaccggccgcgtcttcgtcttctacgcggcctccgtcaaccag
ggcttcttcggctcggccaccggcaacgacgagagcgacccgaacgtcctccaggccgac
tacagctactccgacgacgacggcctgacctggaagcacgagcggatcaccgccgagatc
aagaacccggcctgggcgggcatgttcgccgcctccggcgagggcatccaggtgcgcaac
ggcacctacaagggccgcctgatccagcagtacgccatccgcaacaacggcgccaactac
gcggtcagcgcctacagcgacgaccacggcgccacctggaagatgggtacgcccgtcggt
cccggcggagacgagaacaagaccgtcgaactgtccgacggccgcatcatgctcaacaac
cgctccgccccctaccgcacggtcgcctactcctccgacggcggcgtcacctacacgccg
ttccagcaggacaaggagctgcccgaccccgccaacaacgggtccgtcgcccgcttcgca
cccgacgtgcccgccacccacccccgggcccagtggctgatgttcagcaacacggcgacc
accaacagccgcagcaacctcaccgtccgcctctcctgcgacaacgggcagaactggccg
gtccgcaagacggtggagtccggcgccgccgcctactccaccctcacgccgctcggcacc
ggcacggcgggcaacgaccgggtgggtctgctctgggagcgcgccaactaccagcacatc
acctactcctccttcgacgtgcagtggctcggcggtgtctgcgcgcccgtcaccgtcacc
ccgcccgcgtccctgcccgccgggaggaccaccgaggtcaccgtccgcgtcgtcagccag
aacgacaaggacctgccctccggctcggtcgcgctgaccctgccgtccggctggagcgcg
ccctcggtcaccgtgccggcgctcaagcccggccagggcgcgaacatgcgcgtccccgtc
accgtcccggccggcgcctcgggcggcgcgccggtgaccgccacctacctcgtccgcggc
acccagcggtcctacggtgacggcaccctcaccgtgaccacgtcctga

DBGET integrated database retrieval system