KEGG   Streptomyces sp. Mg1: M444_18845Help
Entry
M444_18845        CDS       T03958                                 

Definition
(GenBank) kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
strm  Streptomyces sp. Mg1
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:strm00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    M444_18845
Enzymes [BR:strm01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     M444_18845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:4380757..4381962
Genome map
AA seq 401 aa AA seqDB search
MSDAAALPALRQRAAHLDTTDDLAKLRDRFALPEGLVYLDGNSLGALPAGVAAVTADVVR
RQWGELLIRSWDESNWWTAPERIGDKLSPLIGAAPGQTVVGDSTSVNLFKALVGAARLAP
PGRTRMLVDANTFPTDGYIAASAARMTGLRVVPVDPATAAEEMDEDTAVVLLNHVDYRTG
RLHDLPALTRAARATGAITVWDLCHSAGALPVGLDEHRVDLAVGCTYKYLNGGPGSPAYL
YIAARHQAAFDSPLPGWNGHAEPFAMTPGYTPADGAVRGRVGTPDILSMLALEAALDAWD
GVSVEQVRAKSLALTDFFLECVAAYVPEGRVRSVTPAEHAHRGSQVSLRTENAAEIMREL
IARGVVGDFRAPDVLRFGFTPLYVGFADVERAARTLGHVFG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgccgcggccctgcccgcgctccggcagcgggcggcccacctcgacaccacc
gacgacctggccaagctccgcgaccgcttcgcgctcccggagggcctcgtctacctggac
ggcaactcgctcggcgcgctcccggccggcgtcgcggccgtcacggccgatgtcgtgcgc
cgtcagtggggcgagctcctcatccgctcctgggacgagagcaactggtggaccgccccc
gaacgcatcggtgacaagctgagccccctcatcggcgcggcccccggccagacggtcgtg
ggcgactccaccagcgtcaacctcttcaaggcgctcgtcggcgcggcccgtctcgccccg
cccggccgcacgcggatgctggtcgacgcgaacaccttccccaccgacggctacatcgcc
gcgtcggccgcccggatgaccggcctgcgcgtcgtcccggtcgacccggccaccgccgcc
gaggagatggacgaggacaccgccgtcgtcctgctcaaccacgtcgactaccgcaccggc
cgcctgcacgacctccccgccctcacccgggcggcccgggcgaccggcgccatcaccgtc
tgggacctctgccacagcgccggggccctgccggtcgggctcgacgagcaccgggtcgac
ctcgcggtgggctgtacgtacaagtacctcaacggcggacccggctccccggcgtacctg
tacatcgcggcccgccaccaggccgccttcgactccccgctccccggctggaacggtcac
gcggagccgttcgcgatgaccccgggctacaccccggccgacggcgcggtccgggggcgg
gtcgggacgcccgacatcctctcgatgctcgctctggaggccgcgctcgacgcgtgggac
ggcgtctcggtcgagcaggtccgggcgaagtccctggccctgaccgacttcttcctcgaa
tgcgtcgcggcgtacgtcccggagggcagggtccggtcggtcacgccggccgagcacgcc
caccgcggcagccaggtctcgctgcgcaccgagaacgcggcggagatcatgcgcgagctg
atcgcgcgcggcgtcgtcggggacttccgggcgccggacgtcctgcgcttcggcttcacc
ccgctctacgtcggtttcgcggacgtggagcgtgccgcgcggacactgggtcacgttttc
gggtga

DBGET integrated database retrieval system