KEGG   Streptomyces sp. Mg1: M444_20900Help
Entry
M444_20900        CDS       T03958                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
strm  Streptomyces sp. Mg1
Pathway
strm00473  D-Alanine metabolism
strm01100  Metabolic pathways
strm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:strm00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    M444_20900
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    M444_20900
Enzymes [BR:strm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     M444_20900
Peptidoglycan biosynthesis and degradation proteins [BR:strm01011]
 Precursor biosynthesis
  Racemase
   M444_20900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AKL67450
UniProt: A0A0G3UR89
LinkDB All DBs
Position
1:4801285..4802424
Genome map
AA seq 379 aa AA seqDB search
MNETATRVYAEIDLDAVRGNVRALRERAPRAQVMAVVKADGYGHGAVPCARAALDAGAAW
IGTATPQEALALRAAGIDAPLMCWLWTPGGPWREAVEAGIDVSVSALWALDEVRAAARAA
GRTARIQLKADTGLGRAGCQPADWAELVGAAVAAQAEGTVRVTGLWSHFACADEPGHPSV
PLQLAAFRDMLAYAEKEGVEPEVRHIANSPATLTLPESHFDLVRCGLAVYGVSPAPELGT
PAQLGLRPAMTLKASVALVKAVPAGHGVSYGHHHVTAADTRLALIPAGYADGVPRHASGR
GPVLVGGKVRTVAGRVAMDQFVVDLGPDDLVEAGDEAVLFGPGDGGEPTAEDWAQAADTI
AYEIVTRIGGRVPRVYRNG
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagacagcgacgcgcgtgtacgccgagatcgatcttgatgccgtacgggggaac
gtgcgcgccctgcgggagcgggcgccgcgcgcccaggtcatggccgtcgtcaaggcggac
ggctacggtcacggcgccgtcccctgcgcccgcgccgccctggacgccggcgcggcgtgg
atcggcaccgccacgccccaggaggccctcgcgctccgcgccgccggcatcgacgctccc
ctcatgtgctggctgtggacccccggcgggccctggcgggaggccgtcgaggccggcatc
gacgtctccgtcagcgccctgtgggccctcgacgaggtacgggccgccgcccgcgccgcc
ggccgcaccgcgcggatccagctgaaggccgacaccggcctcggccgggccggctgccag
cccgccgactgggcggagctcgtcggcgcggccgtcgccgcccaggccgagggcaccgtc
cgggtcaccggcctctggtcgcacttcgcctgcgccgacgagcccggccacccctccgtc
ccgctccagctcgccgcgttccgcgacatgctcgcgtacgccgagaaggagggcgtcgag
cccgaggtccggcacatcgccaactcgcccgcgactctcaccctccccgagagccacttc
gacctcgtccgctgcggcctcgccgtctacggcgtgtcgcccgcccccgagctcggcacg
cccgcccagctcgggctgcgcccggcgatgaccctcaaggcctccgtggcactggtcaag
gccgtccccgccgggcacggcgtcagctacgggcaccaccacgtcaccgccgcggacacg
cgcctcgcgctgatccccgccgggtacgccgacggcgtcccgcgccacgcctccggccgc
gggccggtgctggtcggcggcaaggtccgtaccgtcgccgggcgcgtcgcgatggaccag
ttcgtcgtcgacctcggccccgacgacctggtcgaggccggtgacgaggccgtcctcttc
ggccccggcgacggcggcgaacccaccgccgaggactgggcgcaggccgccgacaccatc
gcgtatgagatcgtcacccgtatcggcggccgggtgccccgggtgtaccgcaacggctga

DBGET integrated database retrieval system