KEGG   Streptomyces sp. Mg1: M444_27900Help
Entry
M444_27900        CDS       T03958                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
strm  Streptomyces sp. Mg1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AKL68620
UniProt: B4VFV0
LinkDB All DBs
Position
1:complement(6434806..6435882)
Genome map
AA seq 358 aa AA seqDB search
MDLPVMPPVKPMLAKSVAKIPPGMQYEAKWDGFRAIVHRDGDEVEIGSRTGKSLTRYFPE
LLVALKENLPARCVVDGEIVIVRDGRLDFDRLTERIHPAASRVNMLAETTPASFVAFDLL
ALGDEALLDTPLADRRNALSQALSTARPPVHLAPATTDAALAREWFERFEGAGLDGVIAK
PLDLPYRPDARLMFKIKHERTADVVIAGFRFHKSGPIVGSLLLGLHDAHGALQHVGVCAA
FPMKRRAELVDELEPLRMPDPEGHPWAAWAEASAHESARLPGAQSRWTGKKDLSWVPLRP
ERVCEVAYDHMEGDRFRHTAQFRRWRPDRTPESCTYAQLEEVVGYDLADVLGRPGPAH
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggatctgccggtgatgccccctgtgaagccgatgctcgccaagtccgtggccaagatc
ccgccgggcatgcagtacgaggccaagtgggacggcttccgggccatcgtccaccgcgac
ggcgacgaggtcgagatcggcagccgcaccgggaagagcctgacccggtactttcccgag
ctgctggtggcgctgaaggagaacctgcccgcccgctgcgtcgtggacggcgagatcgtc
atcgtgcgggacgggcggctcgacttcgaccggctgacggagcggatccatcccgccgcc
tcccgcgtgaacatgctggccgagacgaccccggccagcttcgtcgccttcgatctgctc
gcgctcggcgacgaggcactcctcgacaccccgctcgcggaccgccgtaacgccctctcc
caagccctttccaccgctcggccccccgttcatctcgcgcccgcgaccaccgacgccgcg
ctcgcgcgggagtggttcgagcggttcgagggcgccgggctcgacggggtgatcgccaag
cccctcgatctcccctaccggcccgatgcccgtctcatgttcaagatcaagcacgagcgt
acggccgacgtcgtcatcgcgggtttccgtttccacaagagcggtccgattgtcggatcg
ctgctgctcgggctgcacgacgcgcacggcgcgctccagcacgtgggcgtctgcgccgcc
ttccccatgaagcgccgcgccgagctggtggacgagctcgaaccgctgcggatgccggat
cccgagggtcacccgtgggcggcctgggccgaggcatccgcgcacgagagcgccaggctg
ccgggcgcgcagagccgctggaccggcaagaaggacctctcgtgggtgccgctgcgcccc
gagcgggtctgcgaggtcgcctacgaccacatggagggcgaccgcttccggcacacggcc
cagttccgccggtggcggcccgaccggacgccggagagctgtacgtacgcccagctggag
gaggtcgtcggctacgacctcgccgacgtgctcggccggcccggcccggcgcactga

DBGET integrated database retrieval system