KEGG   Streptomyces sp. Mg1: M444_27905Help
Entry
M444_27905        CDS       T03958                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
strm  Streptomyces sp. Mg1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:6435979..6436977
Genome map
AA seq 332 aa AA seqDB search
MELDAGGRAVRLSNPDKVYFPERGLTKRDVAEYYLAVAPGITRALRDRPTTLERYPDGVE
GESFFQKRAPKNLPDWIPTAHIAFPSGRTADEICPTEPAAVLWAANLGCLTFHPWPVRRE
DTDRPDELRIDLDPQPGTDYHHAVAAAHELRAVLEELGLRGWPKTSGGRGLHVFVPIAPR
WTFTEVRRCAITLGRELERRMPGKVTTAWWKEERGERIFVDYNQTARDRTIASAYSVRPR
PHAPVSAPLRWEEVDDAQPRDFDIVTMPARFAELGDLHADMDEHAFALDAVLELADRQEH
DHGLGDMPYPPDYPKMPGEPKRVQPSRAKHKD
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atcgagctcgacgccggagggcgggcggtacgactgtccaacccggacaaggtctacttc
cccgagcgcgggctcaccaagagggatgtggccgagtactacctggcggtcgcgccgggc
atcacccgcgccctgcgcgaccgccccacgaccctggagcgctatccggacggggtggag
ggcgagtccttcttccagaagcgcgctcccaagaacctgcccgactggattccgaccgcc
cacatcgccttcccgagcgggcgcacggccgatgagatctgcccgaccgaaccggccgcc
gtcctgtgggccgccaacctcgggtgcctcaccttccacccctggccggtgcggcgcgag
gacaccgaccggccggacgagctgcgcatcgacctggatccgcaaccgggcaccgactac
caccacgcggtggccgccgcgcacgaactgcgagcggtgctggaggagttgggcctgcgc
ggctggcccaagacctccggcggccgggggctgcacgtgttcgtgccgatcgcccctcgc
tggaccttcaccgaggtccggcggtgcgcgatcaccctgggccgggaactggagcgccgg
atgccgggcaaggtcaccacggcctggtggaaggaggagcgcggagagcggatcttcgtc
gactacaaccagaccgcgcgcgaccgcaccatcgcctccgcctactcggtccggccccgc
ccgcacgcgccggtgtcggccccactgcgctgggaagaggtcgacgacgcgcagccgcgg
gacttcgacatcgtcacgatgccggcgcgcttcgccgaactgggcgacctgcacgcggac
atggacgagcacgccttcgcgctggacgccgtactcgaactcgccgaccggcaagaacac
gaccacggcctgggcgacatgccctacccgccggactacccgaagatgccgggcgaaccc
aaacgggtccagcccagccgagccaaacacaaggactga

DBGET integrated database retrieval system