KEGG   Streptomyces sp. MOE7: STRMOE7_17305Help
Entry
STRMOE7_17305     CDS       T05374                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00564  Glycerophospholipid metabolism
stro01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:stro00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    STRMOE7_17305
Enzymes [BR:stro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     STRMOE7_17305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ARH91767
UniProt: A0A1W5XPK1
LinkDB All DBs
Position
complement(3937931..3939637)
Genome map
AA seq 568 aa AA seqDB search
MKTAILGPAQRAEALARMAERELDVLVVGSGVVGAGTALDAATRGLCTGLVEARDWASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLLQRLAPHLVKPVPFLYPLQHKGWERWY
AGSGVALYDGMSVSSGHGRGLPVHRHLSHKRALRVAPCLKKDALVGALQYYDAQMDDARY
VTTLVRTAAAYGAHVANRARVVGFLREGERVVGARVEDVEGGTEYEIRAQQIVNATGVWT
DDTQALIGERGQFHVRASKGIHLVVPKDRIHSTTGLILRTEKSVLFVIPWGRHWIIGTTD
TDWDLDKAHPAASSADIDYLLGHVNEVLATPLTRDDVEGVYAGLRPLLAGESDATSKLSR
EHTVAHPVPGLVVVAGGKYTTYRVMAKDAVDEAVHGLDRRVAECVTEDVPLVGAEGYKAL
WNARARIAARTGLHVARIEHLLNRYGSLAEELLELVVADPALGEPLTAADDYLRAEAVYA
CTHEGARHLDDVLTRRTRISIETFDRGTRSAREVAELMAPALGWDDAQIEKEITHYQKRV
EAERESQRQPDDLTADAARLGAPDIVPL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacagcgatactgggaccggcgcaacgggcggaggcactcgcccgaatggcggag
cgggagctggacgtcctcgtggtcggcagcggggtcgtcggggcggggaccgctctggac
gcggcgactcggggactgtgcacggggctggtggaggcgcgggactgggcctcgggcacg
tccagccggtcgagcaagctcatccacggcggtctgcggtatctggagatgctggacttc
gcgctggtgcgtgaggccctcaaggagcgcgggctgctgttgcagcggctggcgccgcat
ctggtcaagccggtgccgtttctctatccgctccagcacaagggctgggagcgctggtac
gcgggatcgggcgtggcgctgtacgacggcatgtcggtgtcgtcggggcacggccgcggg
ctgcccgtccaccggcacctctcgcacaagcgggcgctgcgggtggcgccctgcctgaag
aaggacgcgctggtgggcgcgttgcagtactacgacgcgcagatggacgacgcgcggtac
gtcaccaccctcgtacggaccgcggccgcctacggcgcgcacgtcgccaaccgggcgcgg
gtggtgggttttctgcgcgagggcgagcgggtggtcggcgcgcgggtggaggacgtcgag
ggcggcaccgagtacgagatccgggcgcagcagatcgtcaacgccaccggggtgtggacg
gacgacacccaggcgctgatcggtgagcgcgggcagttccacgtccgcgcctcgaagggg
atccacctggtcgtccccaaggaccggatccattcgacgaccgggctgatcctgcggacc
gagaagagcgtgctgttcgtcatcccgtgggggcggcactggatcatcgggacgaccgac
accgactgggatctggacaaggcgcacccggcggcgtccagcgcggacatcgactatctg
ctcgggcacgtcaacgaggtgctggcgacgccgttgaccagggacgacgtcgagggcgtg
tatgccgggctgcggccgctgctggcgggggagtcggacgccaccagcaagctgtcgcgg
gagcacaccgtggcgcatccggtgccgggcctcgtggtcgtcgccggcggcaagtacacg
acgtaccgggtcatggccaaggacgcggtggacgaggcggtgcacgggctcgaccggcgg
gtcgcggagtgcgtgacggaggacgtgccgctcgtcggggccgagggctacaaggcgctg
tggaacgcgcgggcccggatcgcggcgcgcaccgggctgcacgtggcgcggatcgagcat
ctgctgaaccgctacggctcgctggccgaggagctgctggagctggtggtggccgatccc
gcgctgggcgaaccgctgacggccgccgacgactacctgcgcgcggaggcggtctacgcc
tgcacgcacgagggcgcgcgccatctcgacgacgtgctgacccgccgtacgcggatctcg
atcgagaccttcgaccggggcacccgcagcgcccgtgaggtcgccgaactgatggcgccc
gcgctgggctgggacgacgcccagatcgagaaggagatcacgcactaccagaagcgggtg
gaggcggagcgcgaatcgcagcggcagccggacgacctgacggcggacgcggcgcggctc
ggcgccccggacatcgtgccactctag

DBGET integrated database retrieval system