KEGG   Streptomyces sp. MOE7: STRMOE7_17425Help
Entry
STRMOE7_17425     CDS       T05374                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00473  D-Alanine metabolism
stro01100  Metabolic pathways
stro01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:stro00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    STRMOE7_17425
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    STRMOE7_17425
Enzymes [BR:stro01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     STRMOE7_17425
Peptidoglycan biosynthesis and degradation proteins [BR:stro01011]
 Precursor biosynthesis
  Racemase
   STRMOE7_17425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Dimeth_Pyl
Motif
Other DBs
NCBI-ProteinID: ARH91786
UniProt: A0A1W5XPH5
LinkDB All DBs
Position
complement(3963590..3964795)
Genome map
AA seq 401 aa AA seqDB search
MNETAKRARAVIDLAAVRSNVRTLRDRAPGAELMAVVKSDGYGHGAVHCARAAREAGATW
LGTALPEEAFALRAAGDTGRLMCWLWTPGGPWGKAVEQDIDVSVSGLWALREVVAAARAC
GRTARVQLKIDTGLGRNGCQPADWPELTAAARAAEAEGALTVTGVWSHFACADEPGHPSI
AAQLASFEDALRTAGAAGLRPEVRHIANTPATLTLPHAHYDLVRTGIGIYGVSPSPELGT
PQDFGLRPAMTLEAALASVKRVPGGHGVSYGHLYTTPGETTLALIPLGYADGVPRHASGT
GPVLVAGKWRTVAGRIAMDQFVVDLGGDSAQEGETAVLFGPGDRGEPTAEDWARAAGTIG
YEIVTRIGTRVPRVYVGSGIRSGAAETEAAEGDTAFTGGTA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagacagcgaagcgcgcccgtgccgtgatcgacctcgccgccgtgcggtcgaac
gtccgcacgctgcgggaccgtgcgcccggggcagagctgatggccgtggtcaagtccgac
ggctacggacacggcgcggtgcactgcgcgcgcgccgcccgtgaggccggggcgacctgg
ctgggcaccgcgctgcccgaggaggcgttcgcgctgcgcgcggccggcgacacggggcgg
ctgatgtgctggctgtggacgccgggcgggccctggggcaaggccgtcgagcaggacatc
gacgtctcggtgagcgggctgtgggcgttgcgcgaggtggtcgcggcggcccgcgcctgc
ggccgtaccgcccgcgtccagctcaagatcgacaccggtctcggccgcaacggctgccag
cccgccgactggccggaactgaccgccgccgcccgcgccgccgaggccgagggcgccctc
accgtcaccggcgtctggtcgcacttcgcctgcgccgacgagccggggcacccctcgatc
gccgcccagctcgcctcgttcgaggacgcgctgcggaccgccggggcggccgggctgcgc
cccgaggtgcggcacatcgccaacaccccggccaccctcaccctgccgcacgcccactac
gacctggtgcggaccggcatcggcatctacggcgtctcgcccagccccgagctcggcacc
ccgcaggacttcgggctgcggccggcgatgaccctggaggccgcgctcgcgtcggtcaag
cgggtcccgggcggccacggcgtctcgtacgggcacctgtacaccacgcccggcgagacc
accctcgcgctgatcccgctcggctacgccgacggcgtcccgcggcacgcgtcgggcacc
gggccggtgctggtggccggcaagtggcggacggtcgccgggcggatcgcgatggaccag
ttcgtggtggacctgggcggcgacagcgcccaggagggcgagacggccgtgctcttcggc
cccggcgaccgcggcgagccgaccgcggaggactgggcccgggcggccggaaccatcggc
tacgaaatcgtcacccggatcggaacccgggtgccgcgcgtctatgtgggcagtggcata
cggagcggagcggcagaaaccgaagcagccgagggcgacaccgcgttcacggggggtacg
gcatga

DBGET integrated database retrieval system