KEGG   Streptomyces sp. PAMC 26508: F750_1517Help
Entry
F750_1517         CDS       T02619                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
strp  Streptomyces sp. PAMC 26508
Pathway
Glycolysis / Gluconeogenesis
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:strp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    F750_1517
   00053 Ascorbate and aldarate metabolism
    F750_1517
   00620 Pyruvate metabolism
    F750_1517
  Lipid metabolism
   00071 Fatty acid degradation
    F750_1517
   00561 Glycerolipid metabolism
    F750_1517
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    F750_1517
   00310 Lysine degradation
    F750_1517
   00330 Arginine and proline metabolism
    F750_1517
   00340 Histidine metabolism
    F750_1517
   00380 Tryptophan metabolism
    F750_1517
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    F750_1517
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    F750_1517
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    F750_1517
Enzymes [BR:strp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     F750_1517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1530419..1531813)
Genome map
AA seq 464 aa AA seqDB search
MKAHDGMYIGGEWRPAAGPDTIAVVNPADEQVIGHVPAGTAEDVDAAVRAARAAFPGWAA
TPPAERAGRIAALRDVLAARKDEIAGTVTAELGSPLPLSQAVHAGVPVLVAGSYAELAAS
YAFEEKLGNSTVLLEPVGVVGAITPWNYPLHQIVAKVAPALAAGCTVVLKPAEDTPLTAQ
LFAEAVHEAGLPAGVFNLVTGIGAVAGQALAEHEGVDLVSFTGSTAVGRRIGATAGAAVK
RVALELGGKSANVILPGADLAKAVNVGVANVMSNSGQTCSAWTRMLVDAERYEEAVALAA
TAVAKYVPGKRIGPVVNAEQQARVRGYIEKGVEEGARLVAGGPEAPRDQGYYVSPTVFAD
VTPDMTIAQEEIFGPVLSILRYEDVDDALRIANGTVYGLAGAVWGADDEEAVAFARRMDT
GQVDINGGRFNPLAPFGGYKQSGVGRELGPHGLSEYLQTKSLQF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgcatgacgggatgtacatcggcggggagtggcggcccgccgcgggcccggac
acgatcgcggtcgtgaacccggcggacgagcaggtcatcggccatgtcccggcgggtacg
gccgaggacgtcgacgcggccgtacgtgccgcacgggccgccttccccggctgggcggcc
accccgcccgccgagcgcgccgggaggatcgccgcgctgcgtgacgtactcgccgcccgc
aaggacgagatcgccgggacggtcaccgcggagctcggctcgccgctgccgctctcccag
gcggtgcacgccggcgtgccggtgctggtcgccggttcctacgccgaactcgccgcctcg
tacgccttcgaggagaagctgggcaactcgacggtcctgctggagcccgtcggcgtcgtc
ggcgcgatcacgccctggaactacccgctccaccagatcgtcgccaaggtggccccggcg
ctggccgcgggctgcaccgtcgtcctgaagccggccgaggacaccccgctcaccgcgcag
ctcttcgccgaggccgtccatgaggccggtctgcccgccggcgtcttcaacctggtcacc
ggcatcggggcggtcgcaggtcaggcgctggccgagcacgagggcgtcgacctggtctcg
ttcaccgggtccacggccgtcggcaggcggatcggcgccaccgcgggagcggccgtcaaa
cgcgtcgccctggagctgggcggcaagtccgccaacgtgatcctgcccggtgccgacctc
gccaaggccgtcaacgtcggcgtcgccaacgtgatgtccaactccggccagacctgcagc
gcgtggacccggatgctggtcgacgccgagcggtacgaggaggccgtggcactcgccgcc
accgccgtcgccaagtacgtgccggggaagcggatcggcccggtcgtcaacgccgagcag
caggcccgggtccgcggatacatcgagaagggcgtcgaggagggcgcccgcctcgtcgcg
ggaggccccgaggcgcccagggaccagggctactacgtcagccccacggtcttcgccgac
gtcaccccggacatgacgatcgcccaggaggagatcttcggcccggtcctctccatcctg
aggtacgaggacgtggacgacgccctgcggatcgcaaacggcaccgtctacgggctggcc
ggcgccgtctggggcgcggacgacgaggaggccgtcgccttcgcccgccgcatggacacc
gggcaggtcgacatcaacggcggccgcttcaaccccctggcccccttcggcggttacaag
cagtccggggtgggccgtgaactcggcccccacggcctctccgagtacctccagaccaag
tccctccagttctga

DBGET integrated database retrieval system