KEGG   Streptomyces sp. PAMC 26508: F750_4308Help
Entry
F750_4308         CDS       T02619                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
strp  Streptomyces sp. PAMC 26508
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:strp00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    F750_4308
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    F750_4308
Enzymes [BR:strp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     F750_4308
Peptidoglycan biosynthesis and degradation proteins [BR:strp01011]
 Precursor biosynthesis
  Racemase
   F750_4308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4480251..4481486
Genome map
AA seq 411 aa AA seqDB search
MPSTTGDRLTGHRRSRAQAYGSETLGAMNETATLRARAEIDLAALRANVRVLRARASGAQ
LMAVVKSDAYGHGAVPCARAAQEAGASWLGTATPQEALALRAAGIRGRVMCWLWTPGGPW
REAVEADIDVSVSGMWALDEVVAAATEAGIPARVQLKADTGLGRNGCQPADWPELVSAAR
AAEEAGVLRVTGLWSHFACADEPGHPSIAAQLDVFRDMVACAEKEGVRPEVRHIANSPAT
LTVPESHFDLVRTGIAMYGISPSPELGTSADFGLRPVMTLAASVALVKQVPPGHGISYGH
HYTTAAETTLALVPVGYADGIPRHASGRGPVLVGGAVRRIAGRVAMDQFVVDLGGEVLEA
GAEAVLFGPGDRGEPSAEDWARAADTIAYEIVTRIGVRVPRVHLHEDSGRD
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgccctcgaccaccggtgaccgcctcaccgggcacaggaggtcgagggcacaggcgtac
ggctctgagacactgggcgcgatgaacgagacagcgaccctgagagcccgtgccgagatc
gacctcgccgcgctgcgtgccaatgtgcgcgttctgcgcgcgcgggcgtccggggcacag
ctcatggccgtggtgaagtccgacgcctacgggcacggagcggtgccctgcgccagggcg
gcgcaggaggccggggcgtcctggctgggcaccgccaccccgcaggaggccctcgcgctc
cgtgcggccggcatccggggccgggtgatgtgctggctgtggacgcccggcggcccctgg
cgcgaggcggtcgaggccgacatcgatgtctcggtgagcgggatgtgggcgctcgacgag
gtcgtcgccgccgccacggaggcggggattccggcgcgggtccagctgaaggcggacacg
ggcctgggacgcaacggctgccagcccgccgactggcccgagctcgtctcggccgcccgc
gccgccgaggaggccggtgtgctgcgcgtcaccggtctctggtcgcacttcgcctgtgcg
gacgagccgggccacccgtcgatcgccgcccagctggacgtcttccgcgacatggtggcg
tgcgcggagaaggagggcgtccggcccgaggtgcggcacatcgccaactccccggcgacg
ctcacggtgcccgagtcgcacttcgacctggtgcgcaccggcatcgcgatgtacggcatc
tcgcccagccccgaactgggcacctccgccgacttcgggctgcgcccggtcatgacgctg
gccgcctccgtcgccctggtcaagcaggtgcccccggggcacggcatcagctacggccac
cactacacgaccgctgccgagacgacgctggccctggtgccggtcggctacgcggacggc
atcccgcgccacgcctcgggccggggacccgtcctggtcggaggcgccgtccgcaggatc
gcgggccgggtcgcgatggaccagttcgtggtggacctcgggggagaggtcctggaggcc
ggcgcggaagcggtgctgttcgggccgggcgaccggggcgagccgagcgcggaggactgg
gcgcgggcggcggacaccatcgcctacgagatcgtcacacgcatcggtgtacgcgtcccg
cgcgtccatctccacgaggactccggcagggactga

DBGET integrated database retrieval system