KEGG   Streptomyces sp. PAMC 26508: F750_5720Help
Entry
F750_5720         CDS       T02619                                 

Definition
(GenBank) sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
strp  Streptomyces sp. PAMC 26508
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:strp00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    F750_5720
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    F750_5720
Enzymes [BR:strp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     F750_5720
Bacterial toxins [BR:strp02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   F750_5720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(6051119..6052567)
Genome map
AA seq 482 aa AA seqDB search
MQRRVTLAMLSAAVMVATAAGTATGAPTAAAAAGELTSQDIATQGAGSPYYRIPALTTSV
KGTLLAAYDSRPTLGDLPGNLGIVLRRSTDGGATWQAQQVVRKEAAPKGFGDPSLLVDRT
TGRIFVFYAGSVNQGFFGSGTGNDESDPNVLQADYSYSDDDGVTWTHRRITQQIKNPAWG
GMFAASGEGIQVRNGAYKGRLIQQYAIRNNGANYAVSAYSDDHGATWRTGNPVGPGGDEN
KTVELSDGRIMLNNRSAPYRTIAYSTDGGVNYTPFAQDTALRDPANNGSVMRYAPDAAAS
DPKASWLLFSNTDSSSSRSNLTVKMSCDNGRTWPIRKVVDPGSTAYSTLTRLPDGRLGLL
YERDDYTHITYSSFDLQWLGGTCADITITPPATMKAGTTTEVTVRVVNRMDVTRSAGTLD
LTVPGGWTTEQVAFPATRPGEGANIKVPVTIPAGASGNAELTVTYKADGKQASGSRTVTV
TL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcagagtcaccctcgccatgctctcggccgccgtcatggtggccaccgcggcc
ggtacggccaccggcgcccccaccgccgcggccgcggccggagaactcacctcccaggac
atcgcgacccagggggccggatctccctactaccgcatcccggccctgaccacctccgtc
aagggcaccctgctcgccgcctacgactcccgccccacgctcggcgacctgcccggcaac
ctgggcatcgtgctgcggcgcagcaccgacggcggggcgacctggcaggcccagcaggtg
gtccgcaaggaggccgccccgaaggggttcggcgatccgagcctgctggtggaccgcacc
acgggccggatcttcgtcttctacgccggctccgtgaaccagggcttcttcgggtcgggc
acgggcaacgacgagagcgacccgaacgtcctgcaggccgactacagctactcggacgac
gacggggtgacctggacccaccgccggatcacccagcagatcaagaaccccgcctggggc
ggcatgttcgcggcgtccggcgaaggcatccaggtgcgtaacggcgcctacaagggccgt
ctgatccagcagtacgcgatccggaacaacggcgccaactacgcggtcagcgcgtacagc
gacgaccacggcgcgacctggaggacgggcaacccggtcggtccgggcggggacgagaac
aagacggtcgagctcagtgacggccggatcatgctcaacaaccgttcggcgccctaccgg
accatcgcctactccaccgacggcggggtgaactacacccccttcgcccaggacaccgcc
ctgcgggacccggcgaacaacggctcggtgatgcggtacgccccggacgcggcggcatcg
gacccgaaggcctcgtggctgctgttcagcaacacggacagcagttcctcccggagcaac
ctcaccgtgaagatgtcctgcgacaacgggaggacctggccgatccgcaaggtcgtcgac
cccgggagcacggcgtactcgacgctgacgcgactgccggacgggcggctcggtctgctc
tacgagcgggacgactacacgcacatcacgtactcctccttcgacctccagtggctcggc
ggcacctgcgcggacatcacgatcaccccgcccgccaccatgaaggcgggcaccaccacg
gaggtcacggtccgggtcgtcaaccggatggacgtgacccgcagcgccgggacactcgac
ctgacggtgcccggcggctggacgaccgagcaggtcgcgttcccggcgacacgtccgggt
gaaggcgcgaacatcaaggtcccggtcaccatcccggcgggtgcctcggggaacgccgaa
ctgaccgtgacctacaaggccgacggcaagcaggcctcggggagccgcacggtgaccgtg
accctgtaa

DBGET integrated database retrieval system