KEGG   Streptomyces sp. SAT1: A8713_16785Help
Entry
A8713_16785       CDS       T04706                                 

Definition
(GenBank) kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
strt  Streptomyces sp. SAT1
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:strt00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    A8713_16785
Enzymes [BR:strt01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     A8713_16785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3881503..3882798
Genome map
AA seq 431 aa AA seqDB search
MPDGALAGRAEKLDAADALAAVRERFVLDDVVYLDGNSLGALPAHVPDRVADVVRRQWGE
LRIRSWDESGWWTAPERIGDRIAPLVGAAPGRIVVGDSTSVNVFKALVAAVRMARETGGG
DGSGLAGQAGQAGQGDQADQGGEGSGRDEILVDATTFPTDGYIARSAARMTGCEVRPVAP
AEVPGALSDRTAAVLLNHVDYRTGRLHDLPSLTAAVHAAGAYAVWDLCHSAGALPVGLDE
HGVALAVGCTYKYLNGGPGSPAFLYVRQDLQERFDSPLPGWNSHAEPFGMRPEYEPAHGA
LRGRVGTPDILSLLALEASLEVWDGVPIEAVRAKSLALTDFFLECVAAYVPAGRVECVTP
AEHDLRGSQIALRCPDAGPVMKRLIERGVVGDFRRPDVLRFGFTPLYVGFGDAERAARVL
GEVLAEASDEG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtgccggacggcgccctcgcgggcagggcggagaagctggacgcggccgacgcgctggcc
gccgtgcgggagcggttcgtcctggacgacgtcgtctacctcgacgggaactcgctgggc
gcgctcccggcgcacgtaccggaccgggtcgccgacgtcgtccgccgccagtggggcgag
ctgcgcatccgctcctgggacgagagcggctggtggaccgcgcccgaacggatcggcgac
cggatcgctccgctggtcggggcggcgccgggccggatcgtggtgggcgactcgacgagc
gtcaacgtcttcaaggcgctggtcgcggccgtgcggatggcccgcgagacgggcgggggc
gacgggagcggtctggccggccaggccggccaggccggccaaggcgaccaggccgaccag
ggcggcgaggggtccgggcgggacgagatcctggtcgacgcgaccaccttccccacggac
gggtacatcgcgcggtccgcggcccggatgaccggctgcgaggtgcgccccgtggcgccc
gccgaggtgccgggcgccctgtccgaccggaccgcggcggtgctgctcaaccacgtcgac
taccgcaccggccgcctgcacgacctgccgtcgctcacggccgccgtgcacgcggcgggc
gcgtacgccgtctgggatctgtgccacagcgcgggcgcgctgccggtcggcctggacgag
cacggtgtcgccctggcggtgggctgcacctacaagtacctgaacggcggcccgggttca
ccggccttcctgtacgtccgccaggacctccaggagcggttcgactcgccgctgcccggc
tggaactcgcacgccgagcccttcggcatgcgcccggagtacgaaccggcgcacggcgcg
ctgcgcggccgggtcggcacgcccgacatcctctccctgctcgccctcgaagcctccctg
gaggtctgggacggggtgccgatcgaggcggtgcgggccaagtccctcgcgctcacggac
ttcttcctggagtgcgtcgcggcgtacgtacccgccgggcgcgtggagtgcgtgaccccg
gcggagcacgacctgcgcggcagccagatcgccctgcgctgccccgacgccgggcccgtg
atgaagcggctgatcgaacggggcgtggtcggcgacttccggcggccggacgtcctccgc
ttcggcttcacgccgctctacgtcggcttcggtgacgcggagcgcgcggcgcgggtgctg
ggggaggtgctggcggaggcatcggacgaggggtag

DBGET integrated database retrieval system