KEGG   Streptomyces sp. S10(2016): A4E84_11515Help
Entry
A4E84_11515       CDS       T04777                                 

Definition
(GenBank) glycosidase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
stsi  Streptomyces sp. S10(2016)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stsi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A4E84_11515
Enzymes [BR:stsi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     A4E84_11515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2629697..2631067)
Genome map
AA seq 456 aa AA seqDB search
MARRYLAVAALTAASVVMNPTGAQASPPGTKDVTAVLFEWNFASVARECTTTLGPAGYGY
VQVSPPAEHIQGPQWWTSYQPVSYKIAGRLGDRTAFRNMVDTCHAAGVKVVVDAVVNHMA
AGSGTGTGGSSYTKYNYPGLYSAPDFDDCTGRITNYQDRWNVQHCELVGLADLDTGESYV
RGAIAGYLNDLLSLGVDGFRIDAAKHMDAADLADIKSRLSNPSVYWKQEVIYGSGEAVQP
TEYTSNGDVQEFRYAYDLKRVFNNENLAYLKNYGEGWGYMSSGVSGVFVDNHDTERNGST
LSYKDNANYTLANVFMLAWPYGAPDINSGYEFSDHDAGPPNGGRVNACWQDGWKCQHNWP
EIKSMVGFRNATRGQAVTNWWDNGGDAIAFGRGGKGFVAINHESGSLTRTYQTALPAGTY
CNVQNNTQVTVNGSGQLTTTLGPNTALAIHAAKSTC
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcagatacctcgccgttgccgcgctcaccgcggcttcggttgtcatgaacccg
actggtgcacaggcctccccacctggcaccaaggacgtcaccgccgtcctcttcgagtgg
aacttcgcctcggtcgcccgtgagtgcaccaccaccctcggccccgccggatacggctac
gtccaggtctccccgcccgccgaacacatacagggcccgcagtggtggacctcgtaccag
ccggtcagctacaagatcgccggccggctcggcgaccgcacggccttccggaacatggtg
gacacgtgtcacgcggccggggtgaaggtcgtcgtggacgccgtcgtcaatcacatggcg
gcgggcagcggcaccggcaccggcggctcgtcgtacacgaagtacaactaccccggcctc
tactccgcgcccgacttcgacgactgcacgggccggatcaccaactaccaggaccgctgg
aacgtccagcactgcgaactggtgggcctggccgacctggacaccggcgagtcgtacgtc
cgtggcgccatcgccgggtacctgaacgacctgctctcgctcggcgtcgacggcttccgt
atcgacgcggccaagcacatggacgccgccgacctcgccgacatcaagtcgcggctctcg
aatccctccgtgtactggaagcaggaggtcatctacggcagcggagaggccgtccagccc
accgaatacacgagtaacggcgatgtccaggagttccgctacgcctacgacctcaagcgc
gtcttcaacaacgagaacctcgcttacctgaagaactacggggagggctggggctacatg
agcagcggtgtctccggtgtcttcgtcgacaaccacgacaccgagcgcaacggctcgacc
ctcagctacaaggacaatgccaactacaccctggccaacgtcttcatgctggcctggccc
tacggcgccccggacatcaactccggctacgagttctccgaccacgacgccggcccaccg
aacggcggccgggtgaacgcctgctggcaggacggctggaagtgccagcacaactggccg
gagatcaagtccatggtcggcttccgcaacgccacccggggccaggccgtcaccaactgg
tgggacaacgggggcgacgcgatcgccttcgggcggggcggcaagggtttcgtggccatc
aaccacgagtcgggctccctgacccggacctaccagaccgcactgcccgcggggacgtac
tgcaacgtgcagaacaacacgcaggtgaccgtgaacggcagtggtcagctcaccaccacc
ctcggtccgaacaccgcgctggcgatccacgcggccaagtcgacctgctga

DBGET integrated database retrieval system