KEGG   Streptomyces sp. S10(2016): A4E84_12555Help
Entry
A4E84_12555       CDS       T04777                                 

Definition
(GenBank) galactose mutarotase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
stsi  Streptomyces sp. S10(2016)
Pathway
stsi00010  Glycolysis / Gluconeogenesis
stsi00052  Galactose metabolism
stsi01100  Metabolic pathways
stsi01110  Biosynthesis of secondary metabolites
stsi01120  Microbial metabolism in diverse environments
stsi01130  Biosynthesis of antibiotics
Module
stsi_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:stsi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A4E84_12555
   00052 Galactose metabolism
    A4E84_12555
Enzymes [BR:stsi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     A4E84_12555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim TAT_signal
Motif
Other DBs
NCBI-ProteinID: AMW10271
UniProt: A0A143BYS9
LinkDB All DBs
Position
2864751..2865899
Genome map
AA seq 382 aa AA seqDB search
MELNRRTVIAGAAAAGIAATTLGGTAHATGGRKPVKTLFGKLADGTKVYSWSLENGGTRL
KVLSWGGVVQSLEIPDRRGRYANVSAGFDNLEDYVAKTPYFGALIGRYGNRIGKGKFTLD
GKDYQLSVNDGEQSLHGGTQGFDKRVWDVEPFTKGSDVGLHLYYTSVDGEMGYPGTLKTK
VTYTLTRHGDWRIDYEATTDKATVVNLTSHVYFNLAGEGSGTIEDHELQIAASRYTPTDA
GLIPTGELAKVAGTPFDFRKAKPIGRDIRVSHPQLVTAKGFDHNWVLDKGITARPEHVAT
LRDPASGRTMKIATNEPGLQFYSGNFLDGTLTGPSGRTYRQGDALCLETQHFPDSPNKPK
FPSTVLRPGQTYRTTTIHTFGC
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggaactgaacagacgcacggtcatcgcgggagcagcagcggcgggcatagccgccacc
acgctcggcggcacggcgcacgccacgggaggcaggaagccggtgaagacgctcttcggc
aagctggccgacggcaccaaggtctacagctggtcgctggagaacggcggcacccgcctg
aaggtcctctcctggggcggtgtcgtccagtcactggagatccccgaccgtcgcggccgg
tacgccaacgtctccgcgggcttcgacaacctcgaggactacgtcgcgaagaccccgtac
ttcggcgcgctgatcgggcgttacggcaaccgcatcggcaagggcaagttcaccctggac
ggcaaggactaccagctgtccgtgaacgacggcgagcagagcctgcacggcggcacccag
ggcttcgacaagcgcgtgtgggacgtcgagccgttcaccaagggctccgacgtcggtctg
cacctgtactacacgagcgtcgacggggagatgggctacccgggcacgctcaagacgaag
gtgacgtacaccctcacccggcacggtgactggcgcatcgactacgaggccaccacggac
aaggccactgtcgtcaacctcaccagccacgtctacttcaacctcgccggtgagggcagc
ggcacgatcgaggaccacgagctccagatcgccgcctcccgttacacgcccaccgacgcg
ggcctgatccccacgggcgagctggccaaggtcgcgggcacgccgttcgacttccgcaag
gccaagccgatcggccgggacatccgcgtctcccacccgcagctggtcaccgccaagggc
ttcgaccacaactgggtcctcgacaagggcatcaccgcccgccccgagcacgtggccacc
ctgcgcgacccggcctccggccgcacgatgaagatcgccacgaacgagccgggcctgcag
ttctactccggcaacttcctcgacggcacgctcaccggcccgtccggccgcacctaccgg
cagggcgacgccctgtgcctggagacgcagcacttcccggactcgccgaacaagccgaag
ttcccgtcgacggtgctgcgaccggggcagacgtaccgcacgaccacgatccacacgttc
ggctgctga

DBGET integrated database retrieval system