KEGG   Streptococcus thermophilus JIM 8232: STH8232_0913Help
Entry
STH8232_0913      CDS       T02026                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase (Mn)
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
stu  Streptococcus thermophilus JIM 8232
Brite
Enzymes [BR:stu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     STH8232_0913 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
762725..763330
Genome map
AA seq 201 aa AA seqDB search
MAIILPDLPYAYDALEPYIDAETMTLHHDKHHATYVANANAALEKHPEIGEDLEALLADV
EKIPADIRQALINNGGGHLNHALFWELLSPEKQEPTAEVAAAINEAFGSFEAFQEVFTTA
ATTRFGSGWAWLVVNAEGKLEVVSTPNQDTPISDGKKPILALDVWEHAYYLKYRNVRPNY
IKAFFEIINWNKVAELYAEAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggctattattcttccagatcttccttacgcttacgatgctttggaaccatacattgat
gctgaaacaatgactcttcatcatgacaaacaccatgcaacttacgtggcgaatgctaat
gctgcgcttgaaaaacaccctgaaattggtgaggaccttgaagcgcttttggctgatgta
gaaaaaattccagcagacattcgtcaagcacttattaacaatggtggtggacatcttaac
cacgcacttttctgggaacttttgtcaccagaaaaacaagaaccaactgcagaagtagca
gccgctattaacgaagcattcggttcatttgaagctttccaagaagttttcactacggca
gcgacaactcgttttggttcagggtgggcatggcttgtggttaacgcagaaggtaaactt
gaagttgtttcaactcccaaccaagatacacctatctcagacggtaaaaaaccaatcttg
gcacttgatgtttgggaacatgcttactacctaaaataccgtaacgtacgtccaaactac
atcaaagccttctttgaaatcatcaattggaataaagttgctgagctttacgcagaagct
aaataa

DBGET integrated database retrieval system