KEGG   Streptococcus thermophilus JIM 8232: STH8232_1236Help
Entry
STH8232_1236      CDS       T02026                                 

Gene name
acoC
Definition
(GenBank) acetoin/pyruvate dehydrogenase complex, E2 component, dihydrolipoamide succinyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
stu  Streptococcus thermophilus JIM 8232
Pathway
stu00010  Glycolysis / Gluconeogenesis
stu00020  Citrate cycle (TCA cycle)
stu00620  Pyruvate metabolism
stu01100  Metabolic pathways
stu01110  Biosynthesis of secondary metabolites
stu01120  Microbial metabolism in diverse environments
stu01130  Biosynthesis of antibiotics
stu01200  Carbon metabolism
Module
stu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:stu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STH8232_1236 (acoC)
   00020 Citrate cycle (TCA cycle)
    STH8232_1236 (acoC)
   00620 Pyruvate metabolism
    STH8232_1236 (acoC)
Enzymes [BR:stu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     STH8232_1236 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 IF3_N HlyD_3
Motif
Other DBs
NCBI-ProteinID: CCC19930
UniProt: F8LXE3
LinkDB All DBs
Position
complement(1031789..1033177)
Genome map
AA seq 462 aa AA seqDB search
MAFEIIMPKLGVDMQEGEIIEWKKQEGDVVNEGDILLEIMSDKTNMELEAEDSGVLLKIT
RQAGEIVPVTEVIGYIGAEGEVVADNAAIAPAAEAAPQVEKVADVETPAAKPQPQVAIVH
EGGKIRATPKARKVAREMGIDLAQVLGTGAKGRIHADDVENFKGAQPKATPLARKIAADL
GIDLATVSGTGFGGKITKEDILAISAPAQVKVAAAAPAVEAKPEKVLPEGVEVIPMSAMR
KAISKGMTHSYLTAPTFTLNYDVDMTNLIALRKQVLDPIMNKTGMKVTFTDLIGLAVVRT
LMKEEHRYLNASLINDAQNIELHKFVNLGIAVGLDDGLVVPVVHGADKMSLSDFVVASKD
VIKKAQAGKLKAAEMSGSTFSITNLGMFGTKSFNPIINQPNSAILGVSATIQTPVVVDGE
VVVRPIMGLCLTIDHRIVDGMNGAKFMVDLKHLLENPMELLI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgagattattatgcctaagctcggtgtagacatgcaggaaggtgaaatcatc
gagtggaaaaaacaagagggagacgtggttaacgagggagatatccttcttgaaatcatg
tcagataagacaaacatggaacttgaagcagaagactcaggtgttcttttgaagattacc
cgtcaagctggtgaaatagtaccagttactgaggtgattggttatatcggagctgaagga
gaagttgtggctgataatgctgcaatcgcaccagctgcagaagctgcgccacaagttgaa
aaagttgctgatgtggaaacgcctgctgctaagcctcagccacaagtagctattgttcat
gaaggtggcaaaatacgcgcgacacctaaagcacgtaaagtggcacgtgagatggggatt
gacctcgctcaagttctcggaactggggcaaaagggcgtattcatgcagatgatgttgag
aactttaagggcgctcaacctaaggcaacaccattggctcgcaagattgcagcagacctc
ggtattgatttagctaccgtatctggaacaggatttggtggtaagattactaaggaagat
attcttgcaatcagtgctccagcacaagttaaggtggctgcagccgcacctgcggttgaa
gctaaacctgaaaaagtcttgccagaaggtgtggaagttattccgatgtctgctatgcgt
aaggctatttctaagggaatgacgcactcatacttgactgcaccaacatttactcttaac
tatgatgtggacatgactaaccttatagctcttcgtaagcaagttcttgatccaatcatg
aataagactggtatgaaggtgaccttcactgatttgattggtttggcagttgtgcgtacc
cttatgaaagaggaacaccgttacctcaatgcatccttgattaatgatgcacaaaatatc
gaattacacaaatttgttaatcttggtattgcagttggtctagatgatggcttggttgta
ccagtcgttcatggtgctgataagatgagtttgtctgactttgtggtggcctctaaggat
gtcatcaaaaaagctcaggctggtaaattgaaggcggcagaaatgtcaggttctactttc
tctattactaacttgggaatgtttggaaccaagtcattcaatccaatcattaatcaacct
aactcagctatccttggtgtttcagcaactattcaaacaccggttgttgttgatggtgaa
gttgtcgtgcggccaatcatgggtctttgcttgactattgaccaccgtattgttgatggt
atgaatggtgctaaattcatggttgatttaaagcatttgcttgaaaatccaatggaattg
ttgatttaa

DBGET integrated database retrieval system