KEGG   Streptococcus sp. VT 162: V470_02445Help
Entry
V470_02445        CDS       T03287                                 

Definition
(GenBank) sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
stv  Streptococcus sp. VT 162
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:stv00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    V470_02445
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    V470_02445
Enzymes [BR:stv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     V470_02445
Bacterial toxins [BR:stv02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   V470_02445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
483768..487160
Genome map
AA seq 1130 aa AA seqDB search
MNYKSLDRKQRYGIRKFAVGAASVVIGTVVFGANPVLAQEQANAAGANTETVKPGQGLSE
LPKEVSSGDLAHLDKDLAGKLAAAQDNGVVVDQDHLKKNESAESETPSSTETPAEEANKE
EESEDQGAIPRDYYSRDLKNANPILEKEDVETNAANGQRVDLSSELDKLKKLQNATVHME
FKPDASAPRFYNLFSVSSDTKENEYFTMSVLDNTALIEGRGANGEQFYDKYTDAPLKVRP
GQWNSVTFTVEQPTAELPHGRVRLYVNGVLSRTSLKSGNFIKDMPDVNQAQLGATKRGNK
TVWASNLQVRNLTVYDRALNPDEVQTRSQLFERGELEQKLPEGAKVTEKEDVFEGGRNNQ
PNKDGIKSYRIPALLKTDKGTLIAGTDERRLHHSDWGDIGMVVRRSSDNGKTWGDRIVIS
NPRDNEHAKHAEWPSPVNIDMALVQDPETKRIFAIYDMFLESKAVFSLPGQAPKAYEQVG
DKVYQVLYKQGESGRYTIRENGEVFDPQNRKTDYRVVVDPKKPAYSDKGDLYKGNELIGN
IYFEYSEKNIFRVSNTNYLWMSYSDDDGKTWSAPKDITHGIRKDWMHFLGTGPGTGIALR
TGPHKGRLVIPVYTTNNVSYLSGSQSSRVIYSDDHGETWQAGEAVNDNRPVGNQTIHSST
MNNPGAQNTESTVVQLNNGDLKLFLRGLTGDLQVATSHDGGATWDKEIKRYPQVKDVYVQ
MSAIHTMHEGKEYILLSNAGGPGRNNGLVHLARVEENGELTWLKHNPIQSGKFAYNSLQE
LGNGEYGLLYEHADGNQNDYTLSYKKFNWDFLSKDRISPKEAKVKYAIQKWPGIIAMEFD
SEVLVNKAPTLQLANGKTATFMTQYDTKTLLFTIDPEDMGQRITGLAEGAIESMHNLPVS
LAGSKLSDGINGSEAAIHEVPEFTGGVNAEEAAVHEVPEYTGPIATVGEEPAPTVEKPEF
TGGVNAEEAPVAEMPEYTGPLSTVGEEAAPTVEKPEFTGGVNAVEAAVHELPEFKGGVNA
VLAASNELPEYRGGANFVLAASNDLPEYKGGVNGAEAAVYELPEYKGDTNLVLAAADNKL
SIGQDVTYQAPAAKQDELPNTGSKETNSLISLGLAGVLLSLFAFGKKRKE
NT seq 3393 nt NT seq  +upstreamnt  +downstreamnt
atgaattacaaatctttagatcggaaacagcgatacggaattcgaaaatttgcagtcggg
gcggcgtctgtagtgattggtacagtagtatttggagcaaatccagtcttagctcaagag
caagccaatgcagcaggagccaatacagaaactgtcaaacctggtcaaggtttatcagag
ttgccaaaagaagtgtcctcgggagatcttgctcatttggataaggatttggctggtaaa
ttggcagcagctcaagacaacggcgttgtggtggaccaagatcatttgaaaaaaaatgag
agtgcagaatcagaaactccatcctctacggaaacccctgcagaagaagcaaataaagaa
gaggaatcagaggatcagggtgctattcctcgtgactattactcaagagatttaaaaaat
gccaatcctatccttgaaaaagaagatgttgaaaccaatgcagcaaatggtcagagagtc
gatttatcaagtgaactagacaaactaaagaaacttcaaaatgctacggttcacatggag
ttcaaaccagatgcatcagctccacgtttttacaatctcttctctgtatccagtgacacc
aaggaaaatgagtactttactatgtcggtccttgataatacagctcttattgaagggcgt
ggcgctaacggggagcagttctatgataagtatacagatgctcctttgaaagttcgccct
ggacaatggaattcagtgacctttactgtcgaacaaccaacagcagagttacctcatggt
cgagttcgtctctatgtgaacggtgtcttatcccgtacaagtctcaaatctggtaacttc
atcaaagatatgccagatgttaatcaagctcaacttggagcaaccaaacggggcaataaa
acagtttgggcatcaaacctacaagttcgaaacttaactgtttatgatcgtgctttaaac
ccagatgaagttcaaacacggagtcaattatttgaaagaggtgaattggaacagaaactt
cctgagggagcaaaagtcactgagaaagaagacgtatttgaaggtggtagaaacaatcaa
ccaaataaagatggtatcaagagttatcgtatcccagctcttctcaagacagataaagga
acgctgattgcaggaacggatgaaagacgtttgcaccattctgactggggagatattggg
atggttgttcgtcgcagctcagataatggaaaaacatggggagatagaattgtaatctca
aatcctcgtgacaatgagcacgctaaacatgcagaatggccatctccagtcaatattgat
atggccttggtgcaagaccctgaaacaaagagaatttttgcaatttatgacatgttcctt
gaaagtaaggcagtattttcattgccggggcaagctccgaaagcttatgaacaagtggga
gataaagtttatcaagttttatataagcaaggagaatcaggtcgctatacgattcgagaa
aacggagaggttttcgaccctcaaaatagaaagacagattatcgcgtcgtcgttgaccct
aaaaaaccagcttacagcgataagggggatttgtataaagggaatgagttaatcggaaat
atttattttgagtatagcgagaagaatatttttagagtttccaataccaactacctatgg
atgtcctacagtgatgacgatgggaagacttggtctgcaccaaaagatattactcatggg
attcggaaagattggatgcacttcctaggaactggacctggtacggggattgccttacgt
acaggacctcataagggaagactggtgattccagtttatacaacaaacaacgtttcctac
ctaagtggttcacaatcatctcgtgtaatttattcagatgatcatggtgaaacatggcaa
gcaggggaagcagttaatgataaccgcccagtaggcaaccaaactattcactcttcaacc
atgaataatccaggtgcccaaaatacggagtcaactgttgttcagttgaataatggggat
ctcaagctctttttgcgtgggttgactggtgatcttcaggttgcgaccagtcatgatggg
ggagcaacgtgggataaagaaatcaaacgttatcctcaagtaaaagacgtttatgttcaa
atgtccgctattcacaccatgcatgaaggaaaggaatacattctactcagcaatgctggt
ggtcctggacgcaataatggtttggtccacctagctcgtgttgaggagaatggtgagttg
acatggctgaaacacaatcctatacaaagtggtaagtttgcttacaactcactccaagaa
ctcggaaatggcgaatatggtttgctttatgagcatgcggatggcaatcaaaacgattat
actttatcctataagaaattcaactgggatttcttaagcaaagacagaatttctcctaaa
gaagcaaaagtaaaatatgctattcaaaaatggccaggtattatagccatggagttcgat
tcggaagtattggtcaacaaggctccgacccttcaattggcaaatggcaagacagcaacc
tttatgacccagtacgatacaaaaactctcctattcacaatagacccagaggatatgggt
caaaggattacaggtctagctgagggtgcaattgaaagcatgcacaatttaccagtttct
ttagctggctctaaactaagcgatggtattaatggcagtgaagctgctatccatgaggtt
ccagaattcacaggtggtgttaatgctgaggaagcagcggttcatgaagttccggagtat
acaggtccaatagcaacagtaggtgaagaaccagctccaacagtagaaaaaccagaattc
actggtggtgtcaatgctgaggaagccccagtggcagagatgccagagtacaccggtcca
ttatcaacagtaggagaagaagcagcgccaacggttgaaaagcctgaatttacaggtggg
gtcaacgctgttgaggcagcagtccatgaacttccagagtttaaaggtggcgttaacgcg
gttctagcagcctcaaacgagcttcctgaatatagaggaggtgctaactttgtcttggca
gcttcaaatgaccttccagagtataagggtggcgtcaatggtgctgaggcggcagtctat
gaacttccagagtataagggagacaccaatctagtattggcggcagcagacaacaaactg
tctataggccaagatgtgacctatcaagcgccagcagctaaacaagatgaacttccaaat
acgggaagcaaggaaacaaactcactgatttcccttggtcttgcaggtgttcttttatcc
ttgtttgcatttggcaagaagagaaaagaataa

DBGET integrated database retrieval system