KEGG   Streptococcus sp. VT 162: V470_05310Help
Entry
V470_05310        CDS       T03287                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
stv  Streptococcus sp. VT 162
Brite
Translation factors [BR:stv03012]
 Eukaryotic Type
  Elongation factors
   V470_05310 (tuf)
 Prokaryotic Type
   V470_05310 (tuf)
Mitochondrial biogenesis [BR:stv03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    V470_05310 (tuf)
Exosome [BR:stv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   V470_05310 (tuf)
  Exosomal proteins of breast cancer cells
   V470_05310 (tuf)
  Exosomal proteins of colorectal cancer cells
   V470_05310 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase GrpE
Motif
Other DBs
NCBI-ProteinID: AHZ47843
UniProt: A0A024DF16
LinkDB All DBs
Position
complement(1075697..1076893)
Genome map
AA seq 398 aa AA seqDB search
MAKEKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARRLPSAVNQPKDYASIDAAPEER
ERGITINTAHVEYETEKRHYAHIDAPGHADYVKNMITGAAQMDGAILVVASTDGPMPQTR
EHILLSRQVGVKHLIVFMNKIDLVDDEELLELVEMEIRDLLSEYDFPGDDLPVIQGSALK
ALEGDSKYEDIIMELMNTVDEYIPEPERDTEKPLLLPVEDVFSITGRGTVASGRIDRGTV
RVNDEIEIVGIKEETQKAVVTGVEMFRKQLDEGLAGDNVGVLLRGVQRDEIERGQVIAKP
GSINPHTKFKGEVYILTKEEGGRHTPFFNNYRPQFYFRTTDVTGSIELPAGTEMVMPGDN
VTIDVELIHPIAVEQGTTFSIREGGRTVGSGMVTEIEA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaaatacgatcgtagtaaaccacacgttaacattggtactatcggacac
gttgaccacggtaaaactactttgactgcagctatcacaactgtattggcacgtcgcttg
ccttcagcagttaaccaacctaaagactatgcgtctatcgatgctgctccagaagaacgc
gaacgcggtatcactatcaacactgcgcacgttgagtacgaaactgaaaaacgtcactac
gctcacatcgacgctccaggacacgcggactacgttaaaaacatgatcactggtgccgct
caaatggacggagctatccttgtagtagcttcaactgacggaccaatgccacaaactcgt
gagcacatccttctttcacgtcaggttggtgttaaacaccttatcgtcttcatgaacaaa
attgacttggtagacgacgaagaattgcttgaattggttgaaatggaaatccgtgacctc
ttgtcagaatacgacttcccaggtgacgatcttccagttatccaaggttcagctcttaaa
gctcttgaaggtgactctaaatacgaagacatcatcatggaattgatgaacactgttgat
gagtacatcccagaaccagaacgtgatactgaaaaaccattgcttcttccagtcgaagac
gtattctcaatcactggacgtggtacagttgcttcaggacgtatcgaccgtggtactgtt
cgtgtcaacgacgaaatcgaaatcgttggtatcaaagaagaaactcaaaaagcagttgtt
actggtgttgaaatgttccgtaaacaacttgacgaaggtcttgctggagataacgtaggt
gtccttcttcgtggtgttcaacgtgacgaaatcgaacgtggacaagttatcgctaaacca
ggttcaatcaacccacacactaaattcaaaggtgaagtctacatccttactaaagaagaa
ggtggacgtcacactccattcttcaacaactaccgtccacaattctacttccgtactact
gacgttacaggttcaatcgaacttcctgcaggtactgaaatggtaatgcctggtgataac
gtgactatcgacgttgagttgatccacccaatcgccgtagaacaaggtactacattctct
atccgtgagggtggacgtactgttggttcaggtatggttacagaaatcgaagcttaa

DBGET integrated database retrieval system