KEGG   Streptococcus thermophilus MN-ZLW-002: Y1U_C1435Help
Entry
Y1U_C1435         CDS       T02116                                 

Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
stw  Streptococcus thermophilus MN-ZLW-002
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Y1U_C1435
Enzymes [BR:stw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Y1U_C1435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1400094..1401545
Genome map
AA seq 483 aa AA seqDB search
MTNQTAMQYFEWYLPSDGQHWNNLAEDAQHLADLGISHVWMPPAFKATNKDDVGYGVYDL
FDLGEFDQKGTIRTKYGLKEEYLNAINQLKNVGIIPMADVVLNHKAAADKLETFYVVEVD
PEDRTKVISEPFEIEGWTHFTFDGRQKAYNDFEWHWYHFNGTDFDAKRNKKGIYLIQGDN
KGWAHNDLVDNENGNFDYLMFANLDYRHPEVIENIYEWADWFVETTGVQGFRMDAIKHID
YFFMRNFIRDVKEKQGQDFYVFGEFWNPKEEDNNTYLEKTENRFDLVDVRLHYNLYDASL
KGADYDLTTIFEQTLVKNHPEHAVTFVENHDTQRGQALESTVEEWFKPSAYALILLRKDG
LPCLFYGDYYGIDGEFAQESFKEVLDTLLYARKDLAYGEQTDYFDDPNCIGWTRSGNEDC
TPLAVTISNDAANNKSMEIGSDWAGQTFYDILGNCSDTVTIDEDGWGDFPVSEKSVSVWT
IQD
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatcaaactgcaatgcaatactttgaatggtatctcccaagtgacggccaacat
tggaacaacttagctgaagatgcccaacatctagcagaccttggcatcagccatgtttgg
atgccacctgctttcaaagctactaacaaagatgatgttggttacggagtctatgacctc
tttgaccttggggaattcgaccaaaaaggaaccatacgcaccaaatatggtctcaaggaa
gaataccttaatgccatcaaccaactcaaaaatgttggtatcatccctatggccgatgtt
gtgctcaaccacaaggcagccgcggataaacttgaaaccttttatgtggtagaagttgac
cctgaggaccgtaccaaagtaatcagcgaaccgtttgaaatcgagggttggactcatttc
acttttgacggacgtcagaaagcttacaacgactttgaatggcactggtaccactttaac
gggactgacttcgatgccaaaagaaataaaaaaggtatctatcttatccaaggtgacaac
aaaggctgggcacataatgacttggttgacaatgaaaatggtaactttgactaccttatg
tttgccaacctagattataggcatcctgaagttatagaaaatatttacgaatgggctgac
tggttcgtcgaaacaactggtgtccaaggtttccgaatggatgccatcaagcacattgat
tatttctttatgcgtaattttattcgcgacgtcaaagaaaaacaaggtcaagatttctat
gtttttggtgaattttggaatcccaaggaagaggataataatacttatctcgaaaaaact
gaaaaccgctttgatcttgtggatgttcgccttcattacaatttatatgatgccagcctc
aaaggagcagattacgatttgacgactattttcgaacaaacattggtcaaaaatcaccct
gagcatgcggtaaccttcgtagagaaccatgacacccaacgtggacaagcattggaatct
actgttgaagaatggtttaaaccatctgcctatgccctcatccttcttcgtaaagacggc
cttccttgcctattttatggtgactactatggcattgatggtgagtttgctcaagaaagt
ttcaaagaggtcctagacaccttactttacgctcgtaaagatttggcttatggagagcaa
acagactactttgacgaccctaactgtattggatggacacgctctggtaatgaagactgt
actccattagccgtaaccatttctaatgatgctgccaacaacaaatctatggaaattgga
agtgattgggctggacaaactttctatgatattcttggaaactgctctgatactgtaaca
attgacgaagacgggtggggagacttcccagtctctgaaaaatctgtcagcgtttggaca
attcaagactaa

DBGET integrated database retrieval system