KEGG   Streptococcus pyogenes MGAS1882: MGAS1882_1439Help
Entry
MGAS1882_1439     CDS       T02062                                 

Gene name
alr
Definition
(GenBank) alanine racemase protein Alr
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
stx  Streptococcus pyogenes MGAS1882
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:stx00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    MGAS1882_1439 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    MGAS1882_1439 (alr)
Enzymes [BR:stx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     MGAS1882_1439 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:stx01011]
 Precursor biosynthesis
  Racemase
   MGAS1882_1439 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1415183..1416283)
Genome map
AA seq 366 aa AA seqDB search
MISSFHRPTVARVNLQAIKENVASVQKHIPLGVKTYAVVKADAYGHGAVQVSKALIPQVD
GYCVSNLDEALQLRQAGIDKEILILGVLLPNELELAVANAITVTIASLDWIALARLEKKE
CQGLKVHVKVDSGMGRIGLRSSKEVNLLIDSLKELGADVEGIFTHFATADEADDTKFNQQ
LQFFKKLIAGLEDKPRLVHASNSATSIWHSDTIFNAVRLGIVSYGLNPSGSDLSLPFPLQ
EALSLESSLVHVKMISAGDTVGYGATYTAKKSEYVGTVPIGYADGWTRNMQGFSVLVDGQ
FCEIIGRVSMDQLTIRLPKAYPLGTKVTLIGSNQQKNISTTDIANYRNTINYEVLCLLSD
RIPRIY
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaagtttccatcgcccaacagttgcaagggtcaacttacaagctattaaggag
aatgttgccagtgttcaaaagcatattccactaggggtaaaaacgtatgcagttgtcaag
gctgatgcttatggtcatggtgctgtccaggtgtcaaaagcactcatacctcaagtggat
gggtactgtgtgtcaaatcttgatgaggctttgcaattacgtcaagcaggtattgataaa
gagattttaattcttggggttttgctgccaaatgaattagagttagcagttgctaatgct
attactgttacaatcgctagtttagactggatagctttagctagactggagaaaaaagaa
tgtcaaggtttaaaagttcatgtaaaagttgattctggtatggggcggatcgggcttcgt
tcttcaaaagaagtcaatttattgattgatagtctaaaagagttgggtgctgatgtagaa
ggtatttttactcattttgccacagctgatgaggcagatgatactaaatttaaccagcag
ttacagttttttaaaaagctgatagctggacttgaggataagcctcgtttagtacatgct
agtaattcagccacaagtatctggcatagtgataccatttttaatgctgttcgtttagga
attgtcagttatggtttgaatccaagtggttctgatctaagcttaccatttccactgcaa
gaggctttatctctagaatctagcttagtgcatgtcaagatgatttcagctggtgataca
gtcggttatggagctacttatactgccaaaaagtctgaatatgtagggaccgtcccaatc
ggttatgcagatggctggaccaggaacatgcaaggcttttcggtgttagttgatggacaa
ttctgtgaaattatagggcgtgtatcgatggatcaactgaccatacgacttcccaaagca
tatcctttaggaacaaaagtcactttgattggcagcaatcagcaaaaaaatatttctaca
acagatatcgcaaattaccgtaatacaatcaattatgaagttctatgccttttaagtgac
cgtattcctcggatatattaa

DBGET integrated database retrieval system