KEGG   Sulfitobacter sp. AM1-D1: BOO69_16720Help
Entry
BOO69_16720       CDS       T04555                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
suam  Sulfitobacter sp. AM1-D1
Pathway
suam00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:suam00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BOO69_16720
Enzymes [BR:suam01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BOO69_16720
Transporters [BR:suam02000]
 Other Transporters
  Pores ion channels [TC:1]
   BOO69_16720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C_2 GST_C GST_N_4
Motif
Other DBs
NCBI-ProteinID: APE44862
UniProt: A0A1J0WL12
LinkDB All DBs
Position
3433505..3434098
Genome map
AA seq 197 aa AA seqDB search
MYKVIGSTKSRAFRVMWMLEEMGLPYQQVDAGPRSEEAMKYNPLGKIPALVDGDAVLTDS
VAIMTYLGDKHGKLTAPAGTVDRARQDAMTFWLIDEFDAILWAAAKHSFVFPEDRRVPEI
KDSLKSEFLRSADVLADRLEGPFLMGDQMTHADILACHCVNWSIGAKFPRVNDKLGAWAA
EMRDRPAFKAAQEKVAG
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaagtgatcggttcaacgaaatcccgggccttccgggtcatgtggatgctggaa
gaaatgggcctgccctatcagcaggtggatgccgggccgcggtcggaagaggcgatgaaa
tacaacccgctgggcaagatcccggcactggtcgacggcgacgctgtgttgaccgactcg
gtggcgatcatgacctaccttggcgacaagcacggcaagctgactgcgcccgccggaacc
gtcgaccgcgcccggcaggatgcgatgaccttttggctgatcgacgaattcgacgcgatt
ctctgggcagcggccaagcacagctttgtctttcccgaggaccgccgcgtgccggagatc
aaggacagcctgaagtcggagtttctgcggtctgccgatgtgcttgccgacaggctggag
gggccattcctgatgggtgaccagatgacccatgccgacattctcgcctgtcattgcgtg
aactggtccatcggggcgaaatttccccgcgtcaacgacaagctgggcgcctgggcggcg
gagatgcgggaccgtcccgcgttcaaggcagcacaggaaaaggtcgccggatag

DBGET integrated database retrieval system