KEGG   Staphylococcus aureus subsp. aureus ED133: SAOV_2163cHelp
Entry
SAOV_2163c        CDS       T01869                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sue  Staphylococcus aureus subsp. aureus ED133
Pathway
sue00010  Glycolysis / Gluconeogenesis
sue00053  Ascorbate and aldarate metabolism
sue00071  Fatty acid degradation
sue00280  Valine, leucine and isoleucine degradation
sue00310  Lysine degradation
sue00330  Arginine and proline metabolism
sue00340  Histidine metabolism
sue00380  Tryptophan metabolism
sue00410  beta-Alanine metabolism
sue00561  Glycerolipid metabolism
sue00620  Pyruvate metabolism
sue00625  Chloroalkane and chloroalkene degradation
sue01100  Metabolic pathways
sue01110  Biosynthesis of secondary metabolites
sue01120  Microbial metabolism in diverse environments
sue01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sue00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAOV_2163c
   00053 Ascorbate and aldarate metabolism
    SAOV_2163c
   00620 Pyruvate metabolism
    SAOV_2163c
  Lipid metabolism
   00071 Fatty acid degradation
    SAOV_2163c
   00561 Glycerolipid metabolism
    SAOV_2163c
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAOV_2163c
   00310 Lysine degradation
    SAOV_2163c
   00330 Arginine and proline metabolism
    SAOV_2163c
   00340 Histidine metabolism
    SAOV_2163c
   00380 Tryptophan metabolism
    SAOV_2163c
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAOV_2163c
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAOV_2163c
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAOV_2163c
Enzymes [BR:sue01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SAOV_2163c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADI98618
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(2208708..2210135)
Genome map
AA seq 475 aa AA seqDB search
MRDYTKQYINGEWIESNSNETIEVINPATEEVIGKVAKGNKVDVDKAVEAADNVYLEFRH
TSVKERQALLDKIVKEYENRKDDIVQAITDELGAPLSLSERVHYQMGLNHFVAARDALDN
YEFEERRGDDLVVKEAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAV
ILAEIFDKVGVPKGVFNLVNGDGAGVGNPLSEHPKVRMMSFTGSGPTGSKIMEKAAKDFK
KVSLELGGKSPYIVLDDVDIKEAAKATTGKVVNNTGQVCTAGTRVLVPSKIKDAFLAELK
EQFSQVRVGNPREDGTQVGPIISKKQFDQVQNYINKGIEEGAELFYGGPGKPEGLEKGYF
ARPTIFINVDNQMTIAQEEIFGPVMSVITYNDLDEAIQIANDTKYGLAGYVIGKDKEILH
KVARSIEVGTVEINEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYFK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagagactacacaaagcagtacattaatggcgaatggatagaaagtaatagtaatgaa
acgatagaagttataaatccagcaaccgaagaagtaatcgggaaagttgctaaaggtaat
aaagttgatgttgataaagccgtcgaggcggcagacaatgtttatttagagttccgtcat
acatctgtgaaagaaagacaagcattattagataaaattgtaaaagaatatgaaaacaga
aaagacgatattgtacaagctattacggatgagttaggtgctcctttatcattatctgag
cgtgtccattatcaaatgggactaaatcattttgttgcagcgagagacgcattagataac
tacgaatttgaagaacgccgcggagatgatttagttgttaaagaagctatcggtgtatct
ggcttaattacaccgtggaacttccctacaaaccaaacatcattaaaattagcagcagca
tttgcggctggtagtccagttgtacttaaaccatctgaagaaacaccatttgcagctgtt
attttagctgagatttttgataaagtcggtgttcctaaaggtgtatttaaccttgttaat
ggtgatggtgctggcgttgggaatcctttatctgaacatcctaaagtacgcatgatgtca
tttacaggatcaggccctactggttctaaaattatggaaaaagctgctaaagactttaaa
aaggtatcattagagcttggtggcaaatctccatacatcgtcctagatgacgtagatatt
aaagaagcggctaaagcaacaacaggcaaagttgttaataatactggtcaagtatgtaca
gctggtacacgtgttttagtgcctagcaaaattaaagatgcattcttagctgaattaaaa
gaacaatttagccaagtgcgtgtcggtaatccaagagaagatggtacacaagtaggccct
atcattagtaaaaaacaatttgatcaagtacaaaattatattaataaaggtattgaagaa
ggtgctgaattattttatggtggtcctggtaaaccagaaggacttgaaaaaggatacttt
gcacgtccgacaatttttattaatgtagataatcaaatgacgatagcacaagaagaaatt
tttgggccagtaatgtcagttatcacttataacgatttagatgaagcgattcaaattgca
aatgatacaaaatatggtttggcaggatatgttattggtaaggacaaagaaatattgcat
aaagtagctcgttctattgaagtaggtacagtagaaataaacgaagcaggtagaaagcca
gacttaccatttggtggctataaacaatctggtttaggtcgtgaatggggcgattatggt
attgaagagttcttagaagtgaaatctatagctggctattttaaataa

DBGET integrated database retrieval system