KEGG   Staphylococcus argenteus: SAMSHR1132_15480Help
Entry
SAMSHR1132_15480  CDS       T01767                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
suh  Staphylococcus argenteus
Pathway
suh00010  Glycolysis / Gluconeogenesis
suh00230  Purine metabolism
suh00620  Pyruvate metabolism
suh01100  Metabolic pathways
suh01110  Biosynthesis of secondary metabolites
suh01120  Microbial metabolism in diverse environments
suh01130  Biosynthesis of antibiotics
suh01200  Carbon metabolism
suh01230  Biosynthesis of amino acids
Module
suh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
suh_M00002  Glycolysis, core module involving three-carbon compounds
suh_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
suh_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:suh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAMSHR1132_15480
   00620 Pyruvate metabolism
    SAMSHR1132_15480
  Nucleotide metabolism
   00230 Purine metabolism
    SAMSHR1132_15480
Enzymes [BR:suh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     SAMSHR1132_15480
Membrane trafficking [BR:suh04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SAMSHR1132_15480
Exosome [BR:suh04147]
 Exosomal proteins
  Proteins found in most exosomes
   SAMSHR1132_15480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C PEP-utilizers IF2_N HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: CCE59389
UniProt: A0A077V7Q0
LinkDB All DBs
Position
complement(1704461..1706218)
Genome map
AA seq 585 aa AA seqDB search
MRKTKIVCTIGPASESEEMIEKLINAGMNVARLNFSHGSHEEHKGRIDTIRKVAKRLDKI
VAILLDTKGPEIRTHNMKDGIIELERGNEVIVSMNEVEGTPEKFSVTYENLINDVQVGSY
ILLDDGLIELQVKDIDHDKKEVKCDILNSGELKNKKGVNLPGVRVSLPGITEKDAEDIRF
GIKENVDFIAASFVRRPSDVLEIREILEEQNANISVFPKIENQEGIDNIAEILEVSDGLM
VARGDMGVEIPPEKVPMVQKDLIRQCNKLGKPVITATQMLDSMQRNPRATRAEASDVANA
IYDGTDAVMLSGETAAGLYPEEAVKTMRNIAVSAEAAQDYKKLLSDRTKLVETSLVNAIG
ISVAHTALNLNVKAIVAATESGSTARTISKYRPHSDIIAVTPSEETARQCSIVWGVQPVV
KKGRKSTDALLNNAVATAVETGRVSNGDLIIITAGVPTGETGTTNMMKIHLVGDEIASGQ
GIGRGSVVGTTLVAETVKDLEGKDLSDKVIVTNSIDETFVPYVEKALGLITEENGITSPS
AIVGLEKGIPTVVGVEKAVKNINNNVLVTIDAAQGKIFEGYANVL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaactaaaattgtatgtacaattggaccagcttcagaatcagaagaaatgatt
gaaaaattaatcaatgctggtatgaacgtagcacgattaaacttttcacatggtagtcat
gaagaacacaaaggtagaattgatacaattcgtaaagtagctaaacgcttagataaaatt
gtagcaattttattagatacgaaaggtccagaaattcgtacgcataatatgaaagacggt
atcattgaacttgagcgtggtaacgaagttatcgttagcatgaatgaagttgaaggaaca
cctgaaaagttctcagtaacatatgaaaacttaattaacgatgttcaagtaggttcatac
attttacttgatgatggtttaattgaattacaagttaaagatattgatcatgacaaaaaa
gaagtaaaatgtgacattttaaactcaggtgaacttaaaaacaaaaaaggtgttaactta
cctggagtaagagttagcttacctggtattactgaaaaagatgctgaagatattcgtttc
ggtattaaagaaaatgtagactttatcgcagcaagttttgtacgtcgtcctagtgatgtt
ttagaaattcgtgaaatcttagaagaacaaaatgctaatatttcagtattccctaaaatt
gaaaaccaagaaggtattgataatattgcagaaattcttgaagtatctgatggtttgatg
gttgctcgtggagacatgggtgttgaaatcccacctgaaaaagtgccaatggttcaaaaa
gacttaatcagacaatgtaacaaattaggtaaaccagtaattactgcaactcaaatgtta
gattctatgcaacgtaatcctcgtgctacacgtgccgaagcaagtgacgttgccaatgct
atctatgatggtacagatgcagttatgttatctggtgaaactgcagctggtttataccca
gaagaagctgttaaaacaatgagaaatattgctgtatcagctgaagctgctcaagactac
aaaaaattattatcagatcgtacaaaattagttgaaacttcattagtgaatgcaattggt
atttcagttgcgcacacagctttaaacttaaatgttaaagctatcgtggcagctactgaa
agtggttcaacagcacgtacaatttctaaataccgtccacattcagatatcattgcagta
acgccaagtgaagaaactgcacgtcaatgttcaatcgtatggggtgtgcaacctgtagtt
aaaaaaggacgtaaaagtacggatgcattattaaataatgcagtagctacagcagttgaa
acaggcagagtatcaaatggtgatttaatcattattactgctggtgtaccaactggtgaa
actggaacaactaatatgatgaaaattcatttagttggcgatgaaattgctagtggacaa
ggtattggacgtggctctgtagtaggtactacattagttgctgaaacagtaaaagactta
gaaggtaaagatttatctgataaagtcatcgttacaaactcaattgatgaaacatttgta
ccatatgtagaaaaagctttaggcttaattacagaagaaaatggcatcacttcaccaagt
gcaattgttggattagaaaaaggaattccaacagttgttggcgtagaaaaagctgttaaa
aacataaataataacgtattagttacgattgatgctgctcaaggtaaaatctttgaaggt
tatgcaaacgtactataa

DBGET integrated database retrieval system