KEGG   Sulfuriferula sp. AH1: CAP31_04720Help
Entry
CAP31_04720       CDS       T04857                                 

Gene name
rbcL
Definition
(GenBank) ribulose-bisphosphate carboxylase large subunit
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
sulf  Sulfuriferula sp. AH1
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:sulf00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CAP31_04720 (rbcL)
Enzymes [BR:sulf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     CAP31_04720 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(897045..898466)
Genome map
AA seq 473 aa AA seqDB search
MAVKSYNAGVKEYRATYWTPEYTPLDTDILACFKITPQPGVDREEVAAAVAAESSTGTWT
TVWTDLLTDLDYYKGRAYRIEDVPGDDTCFYAFVAYPIDLFEEGSVVNVLTSLVGNVFGF
KALRALRLEDVRFPIAYVKTCGGPPQGIQVERDKMNKYGRPLLGCTIKPKLGLSAKNYGR
AVYECLRGGLDFTKDDENVNSQPFMRWRDRFEFVHEATLKAERETGERKGHYLNVTAPTP
EEMYKRAEFAKEIGAPIIMHDYLTGGLTANTGLANWCRNNGMLLHIHRAMHAVLDRNPHH
GIHFRVLTKVLRLSGGDHLHSGTVVGKLEGDREATLGWIDTMRDEFIKEDRSRGLFFDQD
WGSMPGVLPVASGGIHVWHMPALVNIFGDDSVLQFGGGTLGHPWGNAAGAAANRVALEAC
VEARNQGVAIEKEGKEILTKAAASSPELKIAMETWKEIKFEFDTVDKLDVAHK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaaaatcatataacgccggtgtgaaagagtaccgcgcaacttactggacgccg
gaatatacgccgctggataccgatattctcgcctgtttcaaaatcacccctcaaccgggt
gttgatcgcgaagaagttgctgctgctgttgctgccgagtcttcaaccggtacctggacc
accgtgtggaccgacctgttgaccgatctggattactacaaaggccgcgcctatcgcata
gaagacgtacctggcgacgacacatgtttctacgctttcgttgcttatccgattgacctg
ttcgaagaaggttccgtcgttaacgtgctgacctcgctggttggtaacgtattcggtttc
aaggcattgcgcgcattgcgtctggaagacgtacgtttcccgatcgcttacgtaaaaacc
tgcggcggtcctcctcaaggcatccaggtcgaacgcgacaaaatgaacaagtatggccgt
ccattgctgggttgcaccatcaaacccaagctgggtctgtctgcgaagaactacggtcgc
gctgtttacgagtgcttgcgcggcggtctggacttcaccaaggacgacgaaaacgtcaac
agccagccgttcatgcgttggcgcgatcgtttcgaattcgtgcacgaagctacattgaag
gctgaacgtgaaactggcgagcgcaaaggccactacctgaacgttaccgcgccaacaccg
gaagaaatgtacaagcgtgcagagttcgccaaggaaatcggcgcaccgatcatcatgcac
gattacctgaccggcggtttgaccgccaacacaggtctggctaactggtgccgcaacaac
ggcatgctgttgcacatccaccgcgccatgcacgccgtgctcgaccgcaacccgcaccac
ggtatccacttccgcgtgctgaccaaggttctgcgtctgtcgggtggtgatcacctgcac
tccggtaccgttgtcggcaaactggaaggcgaccgcgaagcgactctgggctggatcgac
accatgcgtgacgaattcatcaaggaagatcgcagccgcggcctgttcttcgatcaggac
tggggttccatgcccggtgtattgccggttgcatccggcggtattcacgtttggcacatg
ccggcgctggtcaacatcttcggcgatgactccgtattgcaattcggtggcggtacatta
ggccacccatggggtaacgcggctggtgcagctgctaaccgcgtggcactggaagcttgc
gtagaagcacgcaaccagggcgtagccattgagaaggaaggcaaagagatcctgaccaag
gcagctgcaagcagccccgaattgaaaatcgccatggaaacatggaaagaaatcaagttc
gagttcgacactgtcgacaagctggacgttgctcacaagtaa

DBGET integrated database retrieval system