KEGG   Sulfuriferula sp. AH1: CAP31_12700Help
Entry
CAP31_12700       CDS       T04857                                 

Definition
(GenBank) hypothetical protein
Organism
sulf  Sulfuriferula sp. AH1
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2523274..2526102
Genome map
AA seq 942 aa AA seqDB search
MTLHPSPHQPADAAHDAEWLLNIVRELARELRPDAPHLEHLGLDHALERDFGLDSLARVE
LFARIERDLGTRLDEAAFAEAETPRDLLKRIPTGAAIGTVTPATIPVTPPSRLTHPPAGI
DTLTGMLDWRAARHGDEVHIILYSEGDGEHSQNISYRQLRDEAQALAAGLLARGLAVGER
VAIMLPTCREFFVAFYGTIYAGCIPVPLYPPARPSQLEDHMRRIAGIVANAGASMLITDE
RARIPGHLLRAQCEALHEVVTATELADHSPPATLPPVQAQDVAFLQYTSGSTGNPKGVIL
SHANLFANLRAMERASAITADDVFVSWLPLYHDMGLIGACMGSLYVGFRLVLLSPLAFLA
RPGRWLWTIHQYRATVSAAPNFAYELCANKVDDHELEGLTLDSWRIAYNGAEPVSPDTIE
NFSARFARYGYRRETMTPVYGLAENAVGLAFPPPGRGPLIDRVDRNALADEGSARPADAA
DVRARRIVACGRALPEHDFRIVDAAGSVLPERTQGRVQFRGPSATRGYFHNAEATAALFD
GAWLNSGDLGYLAMGELYLTGREKDIIIRAGHNIHPQELEQAISQVQGVRRGGVAVFPAT
DAHSGTERLVVLAETRDTGNAEERSRIMSEINRLAIDLVGMPADDIVLAPPRTVLKTSSG
KVRRAACRELYERGALGGAPRAPWLQVLRLALSGASAQASHLLRRTANGVWAAWAWAVFA
VVVPLAWLMIVLMPVLKLRRRVARGCARLALALTGLTPEIAGLQQLADASPCILVANHSS
YLDALILTAVLPPRFAFVAKQELLAKSRTSIPLRRLGSAFVERFDSARGVEDVQALEERA
RNGDSLVFFPEGTFRAQPGLLPFRIGAFSVAAHSGLPIVPVTLNGTRALLRGETMHPHFA
RLRVWVNAPLQAQGTDWQAALQLRDAARSQILTRLQESDLSG
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcacccgtcgccccaccagcctgccgacgccgcacacgatgcggaatggttg
ctgaacatcgtgcgcgagctggcacgcgagctgcgaccggatgcgccccatctcgaacat
ctggggctggaccatgcactggaacgtgatttcggtctcgacagtctggcgcgggtggag
ctctttgcccgcatcgaacgcgacctgggaacacggcttgacgaggcagcgtttgccgaa
gcggaaacgccgcgcgatctgctgaaacggatcccgactggcgccgcaatcggaaccgtc
acgcctgcaaccatacctgtcacgccaccatcccggctgacgcatccgcccgccgggatc
gacacactcaccggcatgctcgactggcgtgccgcccggcatggcgatgaagtccacatc
atcctgtacagcgaaggtgatggtgaacacagccagaacatcagctaccggcaattgcgc
gatgaagcgcaggcccttgcagccgggctgctggcacgggggctggctgtcggcgagcgc
gttgcgatcatgctgcctacctgccgcgaattcttcgtcgcgttctatggcaccatctac
gcaggctgcataccggtgccgctgtatccgccggcacgtccgtcacagctcgaagaccac
atgcggcgcattgccggcatcgtcgccaatgccggtgccagcatgctgatcactgacgag
cgcgccaggatcccgggacatctgctgcgcgcgcaatgcgaggcgttgcatgaagtcgtc
accgcaacggagctggccgatcacagccctccggcaacgttgccgcccgtgcaagcccag
gacgtcgctttcctgcaatacacctccggcagcaccggcaatccaaaaggggtgatcctc
agccacgccaatctgttcgccaatctgcgtgcaatggagcgcgcttcggcaatcaccgcg
gatgacgttttcgtctcctggctgccgctctaccatgatatgggactgatcggcgcctgc
atgggcagcctctacgtcggcttccggctggtgctgctgtcaccgctggcttttctcgcc
cgccccggccgctggctgtggaccatccatcaatatcgcgctaccgtctcggctgcgccc
aattttgcctacgagctctgcgccaacaaagtggacgatcacgaactcgaaggcctgaca
ctcgacagctggcgcatcgcctacaatggcgccgagccggtcagcccggatacgatcgag
aatttcagcgcccgctttgcccgttacggctaccggcgcgagaccatgacaccggtctac
ggactcgccgaaaatgcggttggcctggcattcccgccgcctggacgcggcccgctgatc
gaccgtgtggatcgaaatgcgctcgcggatgaaggcagtgcccgcccagccgatgcagct
gacgtccgcgcccggcgcatcgtggcctgcggccgcgcactccccgaacacgatttccgc
atcgtcgatgccgccggcagtgtgctgccggaacgcactcagggtcgcgtgcagtttcgc
ggcccgtctgcgacgcgcggctatttccataatgccgaagccacggcagccttgttcgac
ggcgcatggctcaacagcggcgatctgggctatctcgcgatgggcgaactctacctcacc
gggcgcgaaaaggacatcatcatccgtgccgggcacaacatccacccgcaggagctggaa
caggctatcagccaggtgcagggtgtacgccgcggcggtgtggccgtgttcccggccacc
gatgcgcactccggcaccgagcggctggtagtgctggctgagacccgcgacacagggaat
gccgaagagcgcagccggattatgtccgaaatcaaccgtcttgccatcgatcttgtcggc
atgccggccgatgatatcgtgctggcgccgccgcgcacggtgctgaaaacctcgagcggc
aaggtacggcgcgccgcctgccgcgaactgtacgaacgcggcgccttgggcggcgcaccg
cgcgcaccatggctgcaagtactgcggctggcgctgtcaggcgccagcgcccaggcctcg
catctgttgcgccgcactgcaaatggcgtatgggcggcctgggcctgggcggtgtttgcc
gttgtcgtcccgctcgcctggctgatgatcgtgctgatgccggtgctcaaactgcgccgt
cgcgtcgccagagggtgcgcgcgcctcgcgttggcgctcaccgggctgacacccgagatc
gcaggcttgcagcagctggctgacgcttcaccttgcatcctggtcgccaatcattccagc
tatctcgatgcgctgatactgacagcagtcctgccgccgcgtttcgctttcgttgccaaa
caggagctgctggccaagtcacgcacgagcataccgctgcgtcggctgggcagcgccttc
gtcgagcgtttcgacagcgcccgcggcgtggaggatgtacaggcactggaggaacgggcg
cgcaacggcgactcgctggtattctttccggaaggtactttccgcgcccaaccgggatta
ctgccattccggatcggggcattctctgtcgccgcacattccggcctgcccatagtgccg
gtgaccctgaacggcacccgcgccttgctgcgcggcgaaacaatgcacccacatttcgcc
agactgcgggtatgggtaaatgcgccgctgcaggctcaaggcacagactggcaggccgca
ttacaactgcgcgacgcggctcgcagtcagatactgacgcggctgcaggaatccgatctg
tccggctaa

DBGET integrated database retrieval system