KEGG   Candidatus Sulfuricurvum sp. RIFRC-1: B649_11045Help
Entry
B649_11045        CDS       T02537                                 

Definition
(GenBank) hypothetical protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
sulr  Candidatus Sulfuricurvum sp. RIFRC-1
Pathway
sulr00010  Glycolysis / Gluconeogenesis
sulr00020  Citrate cycle (TCA cycle)
sulr00620  Pyruvate metabolism
sulr00633  Nitrotoluene degradation
sulr00640  Propanoate metabolism
sulr00650  Butanoate metabolism
sulr00680  Methane metabolism
sulr00720  Carbon fixation pathways in prokaryotes
sulr01100  Metabolic pathways
sulr01120  Microbial metabolism in diverse environments
sulr01130  Biosynthesis of antibiotics
sulr01200  Carbon metabolism
Module
sulr_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
sulr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sulr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B649_11045
   00020 Citrate cycle (TCA cycle)
    B649_11045
   00620 Pyruvate metabolism
    B649_11045
   00640 Propanoate metabolism
    B649_11045
   00650 Butanoate metabolism
    B649_11045
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    B649_11045
   00680 Methane metabolism
    B649_11045
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    B649_11045
Enzymes [BR:sulr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     B649_11045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: AFV98520
UniProt: K7SCN6
LinkDB All DBs
Position
complement(2198972..2200195)
Genome map
AA seq 407 aa AA seqDB search
MADTIELRDIEVWDGNMAASQALRQVQVDVVAAYPITPSTPIVENYAGFTANGYVDGEFV
MTESEHGAMSCCIGAAAAGGRVATATSSQGFALMLETLYSASGMRLPIVLNLVNRAIGAP
LNVNGDHSDMYMGRDSGWIQFGAYSPQEAYDLNFIAFKVSEDHDVRLPAIVNQDGFMTSH
TAQGVHTLSDEAAYNFVGDYKPMNDMLDLDHPVTHGVQTEEDWHFEHKARQQHALMTAVI
PKIEAAFDEFEKLTGRKYNIVESYNMDDAEVAVVCMGTSVETAREVALEMRAQQGIKAGV
IGIRVFRPWPLEQIADALKNVKAIGSLDRSSPHGAMGALFNELSGSLFNTDTKAVLTNYI
YGLGGRDLTKAHLVSIFQDLKANADAGKPTTPLQQYIGLRGPKLSFF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcagatacaatcgaactacgcgatattgaagtctgggatggaaatatggctgcaagc
caagcgctccgtcaagtacaagttgacgttgtagcggcttacccgatcaccccttcgact
cctatcgttgaaaattatgccggttttacggcaaatggctatgttgacggcgaatttgtc
atgaccgaatccgaacacggtgcaatgtcatgttgtatcggtgctgcagctgcaggcgga
cgggttgcaacggctacatcatcgcaaggttttgccttgatgttggaaacgctttattcc
gcatccggaatgcgtttgccgatcgttctcaatcttgtaaatcgcgctatcggcgcaccg
ttgaacgttaacggtgaccactccgatatgtacatggggcgtgatagcggttggattcaa
tttggtgcttattctccgcaagaggcatacgatttgaactttatcgctttcaaagtttcc
gaagatcatgacgttcgtttaccggcaatcgttaaccaagacggatttatgacatcgcac
acggctcaaggggttcacactctgagcgatgaagcggcttataactttgtcggcgattac
aaaccgatgaatgacatgctggatcttgatcatccggtaactcacggggtacaaacggaa
gaagattggcattttgagcataaagcacgtcagcaacatgctcttatgacagcagttatc
cctaaaatcgaagcagcattcgacgagttcgaaaaattgaccggacgtaaatacaacatc
gttgaatcgtacaatatggacgatgcagaagtagccgttgtatgtatgggaacatcggtc
gaaacagcgcgtgaagttgctcttgagatgcgtgcgcaacagggtattaaagcgggtgtt
atcggtatccgtgtattccgtccttggccattagagcaaattgcagacgcattgaaaaat
gtaaaagcaatcggttcattggatcgttcaagcccgcacggcgcaatgggagctcttttc
aatgagctttcaggttcattgttcaacactgacaccaaagcggttcttacgaactacatc
tacggattgggcggacgtgatttgaccaaagcacacttagtgagtatcttccaagatctt
aaagcaaatgcggatgcgggcaaaccgacaacgccattgcaacaatatatcggtcttcgc
ggaccgaaactctcttttttctaa

DBGET integrated database retrieval system