KEGG   Sulfurospirillum sp. SL2-1: Sdiek1_1525Help
Entry
Sdiek1_1525       CDS       T04910                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
suls  Sulfurospirillum sp. SL2-1
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:suls00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Sdiek1_1525
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sdiek1_1525
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Sdiek1_1525
Enzymes [BR:suls01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Sdiek1_1525
Peptidoglycan biosynthesis and degradation proteins [BR:suls01011]
 Precursor biosynthesis
  Amino acid ligase
   Sdiek1_1525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1465222..1466256
Genome map
AA seq 344 aa AA seqDB search
MTVAVLFGAQSFEHEISVVSAIALKKVLKSDIVYIFCDYYRNFYLIPTDKITSKRFSSGE
YKKDKLLYLKQGGFYAKKMLGEEKIMFDVMINLVHGMDGEDGKLSSMLDFFGVPYIGPRM
EGSCISYNKLFTKLYAKEVGVNVLDYQVLRKGSGASIKIAYPFIVKPLRLGSSIGIGIVK
EEKELAYALDVAFEFDDSVLIEPFISGVKEYNLAGCKTDMFHFSIIEEPQKDEFLDFDKK
YLDFSRTKRVNEAALDIKAEEGIRDAFMKLYDPLFLGALIRCDFFVIDGMTYLNEINPIP
GSMANYLFDDFDRIIKNLSKWLPKSITIPKEYRYINSIQAAKGK
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgactgtagccgttttgtttggcgcccaaagttttgagcatgagattagcgtggtaagt
gccattgctctcaaaaaagtgctaaaaagtgacattgtttatatattttgtgattattac
cgtaatttttatttgattccaaccgataaaattacttcaaaacgttttagcagtggtgaa
tataaaaaagataaactgctctatcttaagcaaggtggtttttacgctaaaaaaatgttg
ggtgaagagaaaataatgttcgatgtcatgattaacctcgtgcatggcatggacggagaa
gatggaaaacttagttctatgcttgatttctttggtgtaccctatattgggcctcggatg
gaaggtagttgtatcagttataacaaactttttacaaagctgtatgccaaggaagtgggg
gttaatgtattagactaccaagtgcttcgtaaaggaagtggtgcatcaattaaaattgct
tatccatttatcgtcaagcctctacgactaggaagttctattggaatagggattgttaaa
gaagaaaaagagcttgcatacgcacttgatgttgcttttgaatttgatgatagtgtccta
atagaaccgtttataagtggtgtaaaagagtacaatcttgcaggttgtaaaaccgatatg
ttccacttttctattatagaagaacctcaaaaagatgaatttttagatttcgataaaaaa
tatttagatttttctcgtacaaaaagagtgaatgaggctgcactagatatcaaagcagaa
gaaggaattcgtgacgcatttatgaagctttatgatccactttttttaggggcacttatt
cgttgtgatttttttgtgattgatggaatgacgtatcttaatgaaatcaacccaattcct
ggtagtatggccaattatctttttgatgattttgatagaataattaaaaatctttcaaaa
tggttgccaaaaagtatcacgattccaaaagaataccgctatatcaactccattcaagca
gctaaaggtaagtaa

DBGET integrated database retrieval system